Recombinant Zebrafish MT2 Protein (1-60 aa), His-tagged
| Cat.No. : | MT2-1744Z |
| Product Overview : | Recombinant Zebrafish MT2 Protein (1-60 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Zebrafish |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-60 aa |
| Description : | Metallothioneins have a high content of cysteine residues that bind various heavy metals. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 8.0 kDa |
| AA Sequence : | MDPCECAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | mt2 metallothionein 2 [ Danio rerio (zebrafish) ] |
| Official Symbol | MT2 |
| Synonyms | mt; mt1; MT-2; wu:fc77e11; wu:fj10c11; |
| Gene ID | 100174951 |
| mRNA Refseq | NM_001131053 |
| Protein Refseq | NP_001124525 |
| UniProt ID | Q7ZSY6 |
| ◆ Recombinant Proteins | ||
| MT2-10158M | Recombinant Mouse MT2 Protein | +Inquiry |
| Mt2-4202M | Recombinant Mouse Mt2 Protein, Myc/DDK-tagged | +Inquiry |
| MT2-5760M | Recombinant Mouse MT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MT2-7169Z | Recombinant Zebrafish MT2 | +Inquiry |
| MT2-1744Z | Recombinant Zebrafish MT2 Protein (1-60 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT2 Products
Required fields are marked with *
My Review for All MT2 Products
Required fields are marked with *
