Recombinant Zebrafish MT2 Protein (1-60 aa), His-tagged

• Cat.No.: MT2-1744Z
• Product Overview: Recombinant Zebrafish MT2 Protein (1-60 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Zebrafish
• Source: Yeast
• Tag: His
• Protein Length: 1-60 aa
• Description: Metallothioneins have a high content of cysteine residues that bind various heavy metals.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 8.0 kDa
• AA Sequence: MDPCECAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: mt2 metallothionein 2 [ Danio rerio (zebrafish) ]
• Official Symbol: MT2
• Synonyms: mt; mt1; MT-2; wu:fc77e11; wu:fj10c11
• Gene ID: 100174951
• mRNA Refseq: NM_001131053
• Protein Refseq: NP_001124525
• UniProt ID: Q7ZSY6