Recombinant Zebrafish MT2 Protein (1-60 aa), His-tagged

Cat.No. : MT2-1744Z
Product Overview : Recombinant Zebrafish MT2 Protein (1-60 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Zebrafish
Source : Yeast
Tag : His
Protein Length : 1-60 aa
Description : Metallothioneins have a high content of cysteine residues that bind various heavy metals.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 8.0 kDa
AA Sequence : MDPCECAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name mt2 metallothionein 2 [ Danio rerio (zebrafish) ]
Official Symbol MT2
Synonyms mt; mt1; MT-2; wu:fc77e11; wu:fj10c11;
Gene ID 100174951
mRNA Refseq NM_001131053
Protein Refseq NP_001124525
UniProt ID Q7ZSY6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MT2 Products

Required fields are marked with *

My Review for All MT2 Products

Required fields are marked with *

0
cart-icon
0
compare icon