Recombinant Zebrafish sod1 Protein, His-SUMO/MYC-tagged
Cat.No. : | sod1-1373Z |
Product Overview : | Recombinant Zebrafish sod1 Protein (1-154aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zebrafish |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 1-154 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 37.1 kDa |
AA Sequence : | MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDK THGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGN AGGRLACGVIGITQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | sod1 superoxide dismutase 1, soluble [ Danio rerio (zebrafish) ] |
Official Symbol | sod1 |
Synonyms | ZSOD; cuzn; Cu/Zn-SOD; sod1 |
Gene ID | 30553 |
mRNA Refseq | NM_131294.1 |
Protein Refseq | NP_571369.1 |
UniProt ID | O73872 |
◆ Recombinant Proteins | ||
SOD1-6992H | Recombinant Human SOD1, GST-tagged | +Inquiry |
SOD1-6332H | Recombinant Human SOD1 Protein (Met1-Gln154), N-His tagged | +Inquiry |
SOD1-1570H | Active Recombinant Human SOD1 Protein, Animal Free, Beta-lactam Antibiotics Free | +Inquiry |
SOD1-956C | Recombinant Cynomolgus SOD1 Protein, His-tagged | +Inquiry |
SOD1-642H | Recombinant Human SOD1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
SOD1-101B | Active Native Bovine SOD | +Inquiry |
SOD1-102B | Active Native Bovine SOD, modified | +Inquiry |
CED026 | Active Bovine Superoxide Dismutase (SOD), High Purity >95% | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOD1-1576HCL | Recombinant Human SOD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All sod1 Products
Required fields are marked with *
My Review for All sod1 Products
Required fields are marked with *
0
Inquiry Basket