Recombinant Zebrafish sod1 Protein, His-SUMO/MYC-tagged
| Cat.No. : | sod1-1373Z |
| Product Overview : | Recombinant Zebrafish sod1 Protein (1-154aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Zebrafish |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 1-154 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 37.1 kDa |
| AA Sequence : | MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDK THGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGN AGGRLACGVIGITQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | sod1 superoxide dismutase 1, soluble [ Danio rerio (zebrafish) ] |
| Official Symbol | sod1 |
| Synonyms | ZSOD; cuzn; Cu/Zn-SOD; sod1 |
| Gene ID | 30553 |
| mRNA Refseq | NM_131294.1 |
| Protein Refseq | NP_571369.1 |
| UniProt ID | O73872 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All sod1 Products
Required fields are marked with *
My Review for All sod1 Products
Required fields are marked with *
Recently Viewed
