Recombinat dog odorant binding protein 2B protein, His tagged.

• Cat.No.: OBP2B-01H
• Product Overview: Recombinat dog odorant binding protein 2B protein with C-terminal His6 fusion tag was expressed in E. coli.

Specification

• Species: Dog
• Source: E.coli
• Tag: His
• Protein Length: 162
• Description: The first step in the process of olfaction is the solubilization of hydrophobic molecules in the hydrophilic nasal mucus. Odorant-binding proteins, believed to transport these molecules within the mucus, are members of the lipocalin family.
• Form: Buffered aqueous solution
• Molecular Mass: 18.27 kDa
• AA Sequence: QDTPALGKDTVAVSGKWYLKAMTADQEVPEKPDSVTPMILKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYTAYEGQRVVFIQPSPVRDHYILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQEILELAQSETCSPGGQHHHHHH
• Purity: ＞90% by SDS-PAGE
• Applications: Antigen for antibody production
  ELISA
• Storage: Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.55 mg/ml
• Storage Buffer: Solution in PBS, pH 7.4

Gene Information

• Gene Name: OBP2B
• Official Symbol: OBP2B
• Synonyms: Odorant binding protein 2B,
• Gene ID: 403830
• mRNA Refseq: NM_001003190.1
• Protein Refseq: NP_001003190.1
• UniProt ID: A0A8I3NBT3