Recombinat dog odorant binding protein 2B protein, His tagged.

Cat.No. : OBP2B-01H
Product Overview : Recombinat dog odorant binding protein 2B protein with C-terminal His6 fusion tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : E.coli
Tag : His
Protein Length : 162
Description : The first step in the process of olfaction is the solubilization of hydrophobic molecules in the hydrophilic nasal mucus. Odorant-binding proteins, believed to transport these molecules within the mucus, are members of the lipocalin family.
Form : Buffered aqueous solution
Molecular Mass : 18.27 kDa
AA Sequence : QDTPALGKDTVAVSGKWYLKAMTADQEVPEKPDSVTPMILKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYTAYEGQRVVFIQPSPVRDHYILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQEILELAQSETCSPGGQHHHHHH
Purity : >90% by SDS-PAGE
Applications : Antigen for antibody production
ELISA
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.55 mg/ml
Storage Buffer : Solution in PBS, pH 7.4
Gene Name OBP2B
Official Symbol OBP2B
Synonyms Odorant binding protein 2B,
Gene ID 403830
mRNA Refseq NM_001003190.1
Protein Refseq NP_001003190.1
UniProt ID A0A8I3NBT3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OBP2B Products

Required fields are marked with *

My Review for All OBP2B Products

Required fields are marked with *

0
cart-icon