Recombinat dog odorant binding protein 2B protein, His tagged.
Cat.No. : | OBP2B-01H |
Product Overview : | Recombinat dog odorant binding protein 2B protein with C-terminal His6 fusion tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | 162 |
Description : | The first step in the process of olfaction is the solubilization of hydrophobic molecules in the hydrophilic nasal mucus. Odorant-binding proteins, believed to transport these molecules within the mucus, are members of the lipocalin family. |
Form : | Buffered aqueous solution |
Molecular Mass : | 18.27 kDa |
AA Sequence : | QDTPALGKDTVAVSGKWYLKAMTADQEVPEKPDSVTPMILKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYTAYEGQRVVFIQPSPVRDHYILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQEILELAQSETCSPGGQHHHHHH |
Purity : | >90% by SDS-PAGE |
Applications : | Antigen for antibody production ELISA |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.55 mg/ml |
Storage Buffer : | Solution in PBS, pH 7.4 |
Gene Name | OBP2B |
Official Symbol | OBP2B |
Synonyms | Odorant binding protein 2B, |
Gene ID | 403830 |
mRNA Refseq | NM_001003190.1 |
Protein Refseq | NP_001003190.1 |
UniProt ID | A0A8I3NBT3 |
◆ Recombinant Proteins | ||
OBP2B-5207H | Recombinant Human OBP2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
OBP2B-701H | Recombinant Human OBP2B Protein, Fc-tagged | +Inquiry |
OBP2B-01H | Recombinat dog odorant binding protein 2B protein, His tagged. | +Inquiry |
OBP2B-702H | Recombinant Human OBP2B Protein, His-tagged | +Inquiry |
OBP2B-1895HFL | Recombinant Full Length Human OBP2B Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OBP2B-3608HCL | Recombinant Human OBP2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OBP2B Products
Required fields are marked with *
My Review for All OBP2B Products
Required fields are marked with *
0
Inquiry Basket