Tnfsf11

  • Official Full Name

    tumor necrosis factor (ligand) superfamily, member 11
  • Overview

    This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found.
  • Synonyms

    TNFSF11;tumor necrosis factor (ligand) superfamily, member 11;ODF;OPGL;sOdf;CD254;OPTB2;RANKL;TRANCE;hRANKL2;tumor necrosis factor ligand superfamily member 11;OTTHUMP00000018328;OTTHUMP00000178585;osteoprotegerin ligand;osteoclast differentiation factor;TNF-related activation-induced cytokine;receptor activator of nuclear factor kappa B ligand;receptor activator of nuclear factor kappa-B ligand

Recombinant Proteins

  • Monkey
  • Mouse
  • Human
  • Rat
  • Cynomolgus
  • Chicken
  • HEK293
  • Human Cells
  • Insect Cells
  • E.coli
  • CHO
  • Mammalian Cells
  • C-His
  • Nicotiana Benthamiana
  • Yeast
  • Human
  • Sf9 Cells
  • Fc
  • His
  • Avi
  • Non
  • GST
  • rFc
  • Flag
  • mFc
  • T7
  • DDK
  • Myc
  • SUMO
Cat.# Product name Source (Host) Species Tag Protein Length Price
TNFSF11-210CAF488 Active Recombinant Monkey TNFSF11 Protein, Fc-tagged, Alexa Fluor 488 conjugated HEK293 Monkey Fc Gly136-Asp317, 442
TNFSF11-210CAF555 Active Recombinant Monkey TNFSF11 Protein, Fc-tagged, Alexa Fluor 555 conjugated HEK293 Monkey Fc Gly136-Asp317, 442
TNFSF11-210CAF647 Active Recombinant Monkey TNFSF11 Protein, Fc-tagged, Alexa Fluor 647 conjugated HEK293 Monkey Fc Gly136-Asp317, 442
TNFSF11-210CF Active Recombinant Monkey TNFSF11 Protein, Fc-tagged, FITC conjugated HEK293 Monkey Fc Gly136-Asp317, 442
TNFSF11-860MAF488 Active Recombinant Mouse Tnfsf11 Protein, Fc-tagged, Alexa Fluor 488 conjugated HEK293 Mouse Fc 505
TNFSF11-860MAF555 Active Recombinant Mouse Tnfsf11 Protein, Fc-tagged, Alexa Fluor 555 conjugated HEK293 Mouse Fc 505
TNFSF11-860MAF647 Active Recombinant Mouse Tnfsf11 Protein, Fc-tagged, Alexa Fluor 647 conjugated HEK293 Mouse Fc 505
TNFSF11-860MF Active Recombinant Mouse Tnfsf11 Protein, Fc-tagged, FITC conjugated HEK293 Mouse Fc 505
TNFSF11-208H Recombinant Human TNFSF11, Fc tagged Human Cells Human Fc 63-244 a.a.
TNFSF11-001H Recombinant Human TNFSF11 Protein, His-tagged Insect Cells Human His 73-317 aa
TNFSF11-209H Active Recombinant Human TNFSF11 protein, Avi-Fc-tagged, Biotinylated HEK293 Human Avi&Fc Gly 64 - Asp 245
TNFSF11-322HAF488 Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 488 conjugated HEK293 Human Fc 418
TNFSF11-322HAF555 Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 555 conjugated HEK293 Human Fc 418
TNFSF11-322HAF647 Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 647 conjugated HEK293 Human Fc 418
TNFSF11-322HF Recombinant Human TNFSF11 Protein, Fc-tagged, FITC conjugated HEK293 Human Fc 418
TNFSF11-424HAF488 Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 488 conjugated HEK293 Human Fc 431
TNFSF11-424HAF555 Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 555 conjugated HEK293 Human Fc 431
TNFSF11-424HAF647 Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 647 conjugated HEK293 Human Fc 431
TNFSF11-424HF Recombinant Human TNFSF11 Protein, Fc-tagged, FITC conjugated HEK293 Human Fc 431
TNFSF11-4499H Recombinant Human TNFSF11 Protein, His (Fc)-Avi-tagged HEK293 Human Avi&Fc&His
TNFSF11-683M Recombinant Mouse TNFSF11 Protein E.coli Mouse Non 158-316 aa
TNFSF11-8548HAF488 Recombinant Human TNFSF11 Protein, None-tagged, Alexa Fluor 488 conjugated HEK293 Human Non 182
TNFSF11-8548HAF555 Recombinant Human TNFSF11 Protein, None-tagged, Alexa Fluor 555 conjugated HEK293 Human Non 182
TNFSF11-8548HAF647 Recombinant Human TNFSF11 Protein, None-tagged, Alexa Fluor 647 conjugated HEK293 Human Non 182
TNFSF11-8548HF Recombinant Human TNFSF11 Protein, None-tagged, FITC conjugated HEK293 Human Non 182
Tnfsf11-9482M Recombinant Mouse Tnfsf11 Protein, His (Fc)-Avi-tagged HEK293 Mouse Avi&Fc&His
Tnfsf11-196R Active Recombinant Rat Tnfsf11 protein, His-tagged CHO Rat His 72-318 a.a.
TNFSF11-210C Active Recombinant Cynomolgus TNFSF11 protein(Gly136-Asp317), hFc-tagged HEK293 Cynomolgus Fc Gly136-Asp317
Tnfsf11-247M Active Recombinant Mouse Tnfsf11, Fc-tagged HEK293 Mouse Fc
TNFSF11-251H Active Recombinant Human TNFSF11 Mammalian Cells Human Non
TNFSF11-252H Active Recombinant Human TNFSF11, Met-tagged E.coli Human 85-245 a.a.
TNFSF11-4744H Active Recombinant Human Tumor Necrosis Factor (ligand) Superfamily, Member 11 E.coli Human Non
Tnfsf11-474M Active Recombinant Mouse Tumor Necrosis Factor (Ligand) Superfamily, Member 11 E.coli Mouse Non
TNFSF11-860M Active Recombinant Mouse TNFSF11 Protein, Fc-tagged HEK293 Mouse Fc 72-316 a.a.
TNFSF11-873H Active Recombinant Human TNFSF11 Protein, His-tagged HEK293 Human His 136-317 a.a.
Tnfsf11-953M Active Recombinant Mouse Tnfsf11 Protein, His-tagged Mammalian Cells Mouse His Arg72-Asp316
TNFSF11-019H Active Recombinant Human TNFSF11 protein, His tagged E.coli Human His 140-317 aa
TNFSF11-1696M Recombinant Mouse TNFSF11 protein, His-tagged C-His Mouse Tyr70-Asp316
Tnfsf11-228M Active Recombinant Mouse tumor necrosis factor superfamily, member 11 Protein, His&GST tagged E.coli Mouse GST&His 143-316aa
TNFSF11-3253H Active Recombinant Human TNFSF11 protein(Gly 63-Asp 244), rFc-tagged HEK293 Human rFc Gly 63-Asp 244
TNFSF11-6124H Recombinant Human TNFSF11 protein, His-Flag-tagged HEK293 Human Flag&His Gly63-Asp244
TNFSF11-6743H Recombinant Human TNFSF11 protein HEK293 Human Non Gly63-Asp244
Tnfsf11-116M Recombinant Mouse Tumor Necrosis Factor (Ligand) Superfamily, Member 11 E.coli Mouse Non
TNFSF11-117H Recombinant Human Tumor Necrosis Factor (Ligand) Superfamily, Member 11 E.coli Human Non
TNFSF11-144H Recombinant Human TNFSF11, His-tagged, Animal Free Nicotiana Benthamiana Human His
TNFSF11-1564H Recombinant human TNFSF11, Active, His-tagged Nicotiana Benthamiana Human His
TNFSF11-1567H Active Recombinant Human TNFSF11 protein, no tag E.coli Human Non
TNFSF11-1679H Recombinant Human TNFSF11 Mammalian Cells Human Non
Tnfsf11-190M Recombinant Mouse Tnfsf11, His-tagged Mammalian Cells Mouse His
Tnfsf11-192M Recombinant Mouse TNFSF11 Yeast Mouse Non
Tnfsf11-198M Recombinant Mouse TNFSF11, Fc-tagged Human Cells Mouse Non 72-316 a.a.
Tnfsf11-2123M Recombinant Mouse Tnfsf11, Fc Chimera HEK293 Mouse Fc 157-316 a.a.
Tnfsf11-2680R Recombinant Rat Tnfsf11 E.coli Rat Non
TNFSF11-31288TH Recombinant Human TNFSF11 E.coli Human Non
TNFSF11-322H Active Recombinant Human TNFSF11 protein, mFc-tagged HEK293 Human mFc Gly63-Asp244
TNFSF11-349H Recombinant Human Tumor Necrosis Factor (ligand) Superfamily, Member 11,His-tagged Human Human His 140-317 a.a.
TNFSF11-3553H Recombinant Human TNFSF11, His-tagged Human Human His
TNFSF11-3677C Recombinant Chicken TNFSF11 Mammalian Cells Chicken His
TNFSF11-3744H Recombinant Human TNFSF11, His-tagged E.coli Human His 149-317 a.a.
TNFSF11-4154H Recombinant Human Tumor Necrosis Factor (ligand) Superfamily, Member 11, GST-tagged Human Human GST
TNFSF11-424H Recombinant Human TNFSF11, Fc tagged Human Cells Human Fc&His 63-244 a.a.
TNFSF11-473H Recombinant Human TNFSF11, FLAG-tagged HEK293 Human Flag 152-317 a.a.
Tnfsf11-528M Recombinant Mouse Tnfsf11 protein, His-tagged HEK293 Mouse His
TNFSF11-59R Recombinant Rat TNFSF11 (RANKL) Yeast Rat Non
TNFSF11-6202R Recombinant Rat TNFSF11 Protein Mammalian Cells Rat His
Tnfsf11-7835M Recombinant Mouse Tnfsf11 protein, His & GST-tagged E.coli Mouse GST&His Leu92~Trp263
Tnfsf11-7836R Recombinant Rat Tnfsf11 protein, His & T7-tagged E.coli Rat His&T7 Glu106~Met240
TNFSF11-8548H Recombinant Human TNFSF11, None tagged Human Cells Human Fc&His 63-244 a.a.
TNFSF11-P1002H Recombinant Human Osteoprotegerin Ligand CHO Human Non
VEGFA-587H Recombinant Human Tumor Necrosis Factor (Ligand) Superfamily, Member 11, His-Fc-Tagged Human Human Fc&His
TNFSF11-001CCL Recombinant Cynomolgus TNFSF11 cell lysate Human Cells Cynomolgus Non
TNFSF11-1093HCL Recombinant Human TNFSF11 cell lysate Human Cells Human Non
TNFSF11-1586MCL Recombinant Mouse TNFSF11 cell lysate Human Cells Mouse Non
TNFSF11-998HCL Recombinant Human TNFSF11 cell lysate Human Cells Human Non
CABT-P1009H Recombinant Anti-Human RANKL Monoclonal Antibody Human Non
RFL26214MF Recombinant Full Length Mouse Tumor Necrosis Factor Ligand Superfamily Member 11(Tnfsf11) Protein, His-Tagged E.coli Mouse His Full L. Full Length (1-316)
RFL35557HF Recombinant Full Length Human Tumor Necrosis Factor Ligand Superfamily Member 11(Tnfsf11) Protein, His-Tagged E.coli Human His Full L. Full Length (1-317)
TNFSF11-0265H Active Recombinant Human TNFSF11 protein, mFc-tagged HEK293 Human mFc Gly 64 - Asp 245
Tnfsf11-031M Recombinant Mouse tumor necrosis factor superfamily, member 11 Protein, Tag Free HEK293 Mouse Non 72-316aa
TNFSF11-0754R Active Recombinant Rat TNFSF11 protein, His-Avi-tagged, Biotinylated HEK293 Rat Avi&His 69-318 a.a.
TNFSF11-0755H Active Recombinant Human TNFSF11 protein HEK293 Human Non 64-245 a.a.
TNFSF11-0756H Active Recombinant Human TNFSF11 protein, His-Avi-tagged, Biotinylated HEK293 Human Avi&His 64-245 a.a.
TNFSF11-0757H Active Recombinant Human TNFSF11 protein(Gly64-Asp245), hFc-tagged HEK293 Human Fc Gly64-Asp245
Tnfsf11-1258M Recombinant Mouse Tnfsf11 Protein, His-tagged HEK293 Mouse His Arg72-Asp316
TNFSF11-151H Recombinant Human TNFSF11 Protein, DYKDDDDK-tagged Human Cells Human Flag
TNFSF11-1529H Recombinant Human TNFSF11 protein, His-tagged HEK293 Human His 63-244aa
TNFSF11-152H Recombinant Human TNFSF11 Protein, DYKDDDDK-tagged Human Cells Human Flag
TNFSF11-1530H Recombinant Human TNFSF11 protein, His-tagged HEK293 Human His 63-244aa&linker(NKLLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLG)
TNFSF11-2023M Recombinant Mouse TNFSF11 Protein, His-tagged Insect Cells Mouse His
TNFSF11-2024M Recombinant Mouse TNFSF11 Protein E.coli Mouse Non
TNFSF11-2025R Recombinant Rat TNFSF11 Protein E.coli Rat Non
Tnfsf11-2138M Recombinant Mouse Tnfsf11 Protein, His-tagged E.coli Mouse His Ala73-Ile315
TNFSF11-2200H Active Recombinant Human TNFSF11 protein HEK293 Human Non Gly64-Asp245
TNFSF11-254H Active Recombinant Human TNFSF11 Protein E.coli Human
TNFSF11-255M Active Recombinant Mouse TNFSF11 Protein E.coli Mouse
TNFSF11-2650H Recombinant Human TNFSF11 Protein, Myc/DDK-tagged, C13 and N15-labeled HEK293 Human DDK&Myc
TNFSF11-302H Active Recombinant Human TNFSF11 Protein (Glu143-Asp317), C-His tagged, Animal-free, Carrier-free E.coli Human His Glu143-Asp317
TNFSF11-316H Recombinant Active Human TNFSF11 Protein, His-tagged(C-ter) E.coli Human His 143-317 a.a.
Tnfsf11-317M Recombinant Active Mouse TNFSF11 Protein, His-tagged(C-ter) E.coli Mouse His
Tnfsf11-3604M Recombinant Mouse Tnfsf11 protein, His-SUMO-tagged E.coli Mouse His&SUMO 70-316aa
TNFSF11-394H Active Recombinant Human TNFSF11 protein, His-tagged HEK293 Human His Gly 64 - Asp 245
TNFSF11-395H Recombinant Human TNFSF11 protein, Fc-tagged HEK293 Human Fc 182
TNFSF11-425H Active Recombinant Human TNFSF11 protein, rFc-tagged(HPLC-verified) HEK293 Human rFc Gly64-Asp245
TNFSF11-4498H Recombinant Human TNFSF11 Protein, His (Fc)-Avi-tagged HEK293 Human Avi&Fc&His
TNFSF11-4498H-B Recombinant Human TNFSF11 Protein Pre-coupled Magnetic Beads HEK293 Human
TNFSF11-459H Recombinant Human TNFSF11 Protein, His-tagged HEK293 Human His 317
TNFSF11-5227H Recombinant Human TNFSF11 Protein (Tyr69-Asp317), C-His tagged Mammalian Cells Human His Tyr69-Asp317
TNFSF11-5228H Recombinant Human TNFSF11 Protein (Gly136-Asp317), N-Fc tagged Mammalian Cells Human Fc Gly136-Asp317
TNFSF11-5859R Recombinant Rat TNFSF11 Protein, His (Fc)-Avi-tagged HEK293 Rat Avi&Fc&His
TNFSF11-5859R-B Recombinant Rat TNFSF11 Protein Pre-coupled Magnetic Beads HEK293 Rat
Tnfsf11-6551M Active Recombinant Mouse Tnfsf11 Protein E.coli Mouse
Tnfsf11-6552M Active Recombinant Mouse Tnfsf11 Protein, His-tagged Sf9 Cells Mouse His Lis158-Asp316
TNFSF11-6646H Recombinant Human TNFSF11 Protein (Ile140-Asp317), N-His tagged E.coli Human His Ile140-Asp317
TNFSF11-6647H Recombinant Human TNFSF11 Protein (Gly136-Asp316), N-Fc tagged Mammalian Cells Human Fc Gly136-Asp316
Tnfsf11-6784M Recombinant Mouse Tnfsf11 Protein (Ala73-Asp316), C-His tagged Mammalian Cells Mouse His Ala73-Asp316
TNFSF11-762H Recombinant Human TNFSF11 protein, His-Flag-tagged HEK293 Human Flag&His Leu160-Val313
Tnfsf11-85M Active Recombinant Mouse Tnfsf11 Protein (Pro143-Asp316), C-His tagged, Animal-free, Carrier-free E.coli Mouse His Pro143-Asp316
Tnfsf11-9481M Recombinant Mouse Tnfsf11 Protein, His (Fc)-Avi-tagged HEK293 Mouse Avi&Fc&His
Tnfsf11-9481M-B Recombinant Mouse Tnfsf11 Protein Pre-coupled Magnetic Beads HEK293 Mouse

    Background

    What is TNFSF11 Protein?

    TNFSF11 gene (TNF superfamily member 11) is a protein coding gene which situated on the long arm of chromosome 13 at locus 13q14. This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. The TNFSF11 protein is consisted of 317 amino acids and TNFSF11 molecular weight is approximately 35.5 kDa.

    What is the Function of TNFSF11 Protein?

    TNFSF11, also known as RANKL, is mainly involved in the differentiation and activation of osteoclasts as a key factor, and is an important regulator in the process of bone resorption. RANKL binds to its receptor RANK and activates a variety of signaling pathways, leading to osteoclast-specific gene transcription, thereby promoting osteoclast maturation and functional performance. In addition, RANKL enhances the ability of dendritic cells to stimulate naive T cell proliferation and may play an important role in the regulation of T-cell-dependent immune responses. In addition, RANKL expression is regulated by cell type-specific distal enhancers, and in T cells, this regulation is achieved by multiple distal elements

    TNFSF11-7.jpg

    Fig1. B cells and T cells are primary RANKL expression cells in periodontal bone resorption. (Bin Chen, 2014)

    TNFSF11 Related Signaling Pathway

    RANKL binds to its receptor RANK and activates the NF-κB signaling pathway. This pathway mainly controls the processes of cell proliferation, differentiation and immune response. RANKL can also influence cell survival and death by activating mitogen-activated protein kinase (MAPK) signaling pathways, such as inducing apoptosis or necrosis. RANKL is a key factor in osteoclast formation. By binding with RANK, it promotes the differentiation and maturation of osteoclasts, thus affecting bone resorption. RANKL-RANK signaling is essential for maintaining bone health and function. RANKL can also promote apoptosis and necrosis of cells, typically through the formation of cytoplasmic complex II, which involves dissociation of TRADD from complex I, and recruitment of FADD and procaspase-8, leading to caspase-8 activation and apoptosis induction.

    TNFSF11 Related Diseases

    Abnormal functioning of TNFSF11 (RANKL) is associated with a variety of diseases, especially bone-related diseases such as osteoporosis, which lead to increased bone resorption by affecting osteoclast differentiation and activity; Osteosclerosis, reduced bone formation due to loss of RANKL function; As well as some autoimmune diseases, in which RANKL is involved in regulating the activity of immune cells, dysregulation of which can lead to inflammatory responses and tissue damage. In addition, abnormal activation of RANKL signaling pathway is also associated with the occurrence and development of some cancers.

    Bioapplications of TNFSF11

    TNFSF11 (RANKL), as a key signaling molecule, has a wide range of applications in medicine and biotechnology, especially in the treatment of osteoporosis, where the use of RANKL inhibitors such as Denosumab can effectively slow bone resorption, increase bone mineral density and reduce the risk of fracture. At the same time, RANKL's role in promoting osteoblast differentiation and bone formation also makes it a potential application value in fracture healing, bone defect repair and tissue engineering. In addition, RANKL's function in immune regulation also allows it to play a role in the treatment of certain autoimmune diseases, by regulating the RANKL-RANK signaling pathway, it can control the inflammatory response and the activity of immune cells.

    Case Study

    Case Study 1: Mineon Park, 2021

    Prostate cancer (PCa) morbidity in the majority of patients is due to metastatic events, which are a clinical obstacle. Therefore, a better understanding of the mechanism underlying metastasis is imperative if we are to develop novel therapeutic strategies. Receptor activator of nuclear factor kappa-B (NF-κB) ligand (RANKL) regulates bone remodelling. Thus, agents that suppress RANKL signalling may be useful pharmacological treatments. Here, preclinical experimental models were used to investigate whether an inactive form of RANKL affects bone metastasis in RANKL-induced PCa. RANKL was associated with epithelial-mesenchymal transition (EMT) and expression of metastasis-related genes in PC3 cells. Therefore, researchers proposed a strategy to induce anti-cytokine antibodies using mutant RANKL as an immunogen. RANKL promoted migration and invasion of PC3 cells through EMT, and induced a significant increase in binding of β-catenin to TCF-4, an EMT-induced transcription factor in PCa cells, via mitogen-activated protein kinase and β-catenin/TCF-4 signalling.

    TNFSF11-1.jpg

    Fig1. Treatment with hRANKL led to a significant increase in the migratory capacity of PC3 cells.

    TNFSF11-2.jpg

    Fig2. Three-dimensional micro-CT images revealed the trabecular bone architecture of the volume of interest in SHAM and mRANKL-immunized (IMMUNIZATION) mouse femurs.

    Case Study 2: Jiawei Fan, 2023

    Although ILC2s have been implicated in CRSwNP, the presence and role of TNFSFs in ILC2-mediated type 2 inflammation in CRSwNP has not been elucidated. Here, researchers investigate the involvement of TNFSFs in ILC2-mediated type 2 inflammation in CRSwNP. The receptor activator of NF-κB (RANK) ligand (RANK-L (TNFSF11)) was significantly elevated in nasal polyps (NPs), and that the receptor of RANK-L, RANK, was expressed on ILC2s in human peripheral blood and NPs. An agonistic antibody against RANK induced production of type 2 cytokines in human ILC2s, and TSLP significantly enhanced this reaction. The membrane-bound RANK-L was detected mainly on CD45 + immune cells, including TH2 cells in NPs. The co-culture of NP-derived ILC2s and TH2 cells significantly enhanced production of type 2 cytokines, and anti-RANK-L monoclonal antibody suppressed this enhancement.

    TNFSF11-3.jpg

    Fig3. Expression of RANK-L protein in tissue homogenates was determined by Luminex.

    TNFSF11-4.jpg

    Fig4. Representative flow cytometric plots for RANK-L+ cells in NPs are shown.

    Quality Guarantee

    High Purity

    SDS-PAGE (TNFSF11-395H).jpg

    Fig1. SDS-PAGE (TNFSF11-395H)

    .

    SDS-PAGE (TNFSF11-2650H).jpg

    Fig2. SDS-PAGE (TNFSF11-2650H)

    Involved Pathway

    Tnfsf11 involved in several pathways and played different roles in them. We selected most pathways Tnfsf11 participated on our site, such as Cytokine-cytokine receptor interaction,NF-kappa B signaling pathway,Osteoclast differentiation, which may be useful for your reference. Also, other proteins which involved in the same pathway with Tnfsf11 were listed below. Creative BioMart supplied nearly all the proteins listed, you can search them on our site.

    Pathway Name Pathway Related Protein
    Prolactin signaling pathway PIK3R1,MAP2K2,MAPK11,INS1,MAPK3,MAPK10,SOCS5,LHB,TH,SOCS4
    NF-kappa B signaling pathway BCL2A1,ERC1,ATM,MAP3K7,IRAK1,CCL21,IL-8,BCL10,TLR4,CCL4L1
    Rheumatoid arthritis TNFRSF11A,ITGB2,ATP6V1G1,HLA-DQA1,IL17A,CCL3L3,FOS,ATP6V1C2,HLA-DRB4,ATP6V0C
    Osteoclast differentiation FCGR3A,FCGR1,LILRB5,PLCG2,GAB2,FHL2,PIK3CA,IL1A,BTK,PIK3CB
    Cytokine-cytokine receptor interaction CCL19,CCL3L3,CCL15,IFNK,CCL14,LEPR,PRLR,PF4V1,CXCL5,CXCL8B.3

    Protein Function

    Tnfsf11 has several biochemical functions, for example, cytokine activity,tumor necrosis factor receptor binding,tumor necrosis factor receptor superfamily binding. Some of the functions are cooperated with other proteins, some of the functions could acted by Tnfsf11 itself. We selected most functions Tnfsf11 had, and list some proteins which have the same functions with Tnfsf11. You can find most of the proteins on our site.

    Function Related Protein
    tumor necrosis factor receptor superfamily binding FADD,TNFSF4,TNFSF9,TNFSF18
    tumor necrosis factor receptor binding TNFSF14,TNFSF13,BRE,CASP8,TRAF4,TNFSF13B,TNFSF4,ERAP1,TRADD,Fasl
    cytokine activity GREM1,GDF3,CER1,OSM,CCL20B,BMP3,TNFSF13B,WNT1,IL29,INHBC

    Interacting Protein

    Tnfsf11 has direct interactions with proteins and molecules. Those interactions were detected by several methods such as yeast two hybrid, co-IP, pull-down and so on. We selected proteins and molecules interacted with Tnfsf11 here. Most of them are supplied by our site. Hope this information will be useful for your research of Tnfsf11.

    MED24;SBF1;DDAH2;PLK1;LMO4;EEF1A1;MBTPS1;EZH2;SNRNP35;ZC3HC1;TRMT2A;BBS10;FAM213B;PHAX;TMOD3;CEP126

    Tnfsf11 Related Signal Pathway

    Resources

    Unlocking the Secrets of TNFSF11 Protein: RANKL's Role in Bone Health and Immunity

    Unlocking the Secrets of TNFSF11 Protein: RANKL's Role in Bone Health and Immunity

    Gene Families

    References

    • Baldo, BA; et al. Adverse events to monoclonal antibodies used for cancer therapy Focus on hypersensitivity responses. ONCOIMMUNOLOGY 2:-(2013).
    • Pise-Masison, CA; Radonovich, M; et al. Gene expression profiling of ATL patients: compilation of disease-related genes and evidence for TCF4 involvement in BIRC5 gene expression and cell viability. BLOOD 113:4016-4026(2009).

    Ask a Question for All Tnfsf11 Products

    Required fields are marked with *

    My Review for All Tnfsf11 Products

    Required fields are marked with *