Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Synthesized Human B-type Natriuretic Peptide

Cat.No. : NPPB-1857H
Product Overview : B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C143H244N50O42S4.
  • Specification
  • Gene Information
  • Related Products
Description : Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
Species : Human
Form : Sterile Filtered White lyophilized (freeze-dried) powder. The protein was lyophilized without additives.
AA Sequence : SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Purity : Greater than 95.0% as determined by RP-HPLC.
Storage : Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution B-type Natriuretic Peptide should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Reconstitution : It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Gene Name : NPPB natriuretic peptide B [ Homo sapiens ]
Official Symbol : NPPB
Synonyms : NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP;
Gene ID : 4879
mRNA Refseq : NM_002521
Protein Refseq : NP_002512
MIM : 600295
UniProt ID : P16860
Chromosome Location : 1p36.2
Pathway : MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem;
Function : diuretic hormone activity; hormone activity; peptide hormone receptor binding; receptor binding; receptor binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends