Synthesized Human B-type Natriuretic Peptide
Cat.No. : | NPPB-1857H |
Product Overview : | B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C143H244N50O42S4. |
- Specification
- Gene Information
- Related Products
Description : | Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function. |
Species : | Human |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. The protein was lyophilized without additives. |
AA Sequence : | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH. |
Purity : | Greater than 95.0% as determined by RP-HPLC. |
Storage : | Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution B-type Natriuretic Peptide should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Reconstitution : | It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Gene Name : | NPPB natriuretic peptide B [ Homo sapiens ] |
Official Symbol : | NPPB |
Synonyms : | NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP; |
Gene ID : | 4879 |
mRNA Refseq : | NM_002521 |
Protein Refseq : | NP_002512 |
MIM : | 600295 |
UniProt ID : | P16860 |
Chromosome Location : | 1p36.2 |
Pathway : | MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem; |
Function : | diuretic hormone activity; hormone activity; peptide hormone receptor binding; receptor binding; receptor binding; |
Products Types
◆ Recombinant Protein | ||
NPPB-6170M | Recombinant Mouse NPPB Protein, His (Fc)-Avi-tagged | +Inquiry |
Nppb-389M | Recombinant Mouse Nppb Protein, His&SUMO-tagged | +Inquiry |
NPPB-2826H | Recombinant Human NPPB Protein, His-tagged, OVA Conjugated | +Inquiry |
Nppb-1852M | Recombinant Mouse Nppb Protein, His&GST-tagged | +Inquiry |
NPPB-1298H | Recombinant Human NPPB Protein, GST-tagged | +Inquiry |
◆ Native Protein | ||
Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
◆ Lysates | ||
NPPB-3734HCL | Recombinant Human NPPB 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket