Synthesized Human B-type Natriuretic Peptide

Cat.No. : NPPB-1857H
Product Overview : B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C143H244N50O42S4.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Description : Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
Form : Sterile Filtered White lyophilized (freeze-dried) powder. The protein was lyophilized without additives.
AA Sequence : SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Purity : Greater than 95.0% as determined by RP-HPLC.
Storage : Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution B-type Natriuretic Peptide should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Reconstitution : It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Gene Name NPPB natriuretic peptide B [ Homo sapiens ]
Official Symbol NPPB
Synonyms NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP;
Gene ID 4879
mRNA Refseq NM_002521
Protein Refseq NP_002512
MIM 600295
UniProt ID P16860
Chromosome Location 1p36.2
Pathway MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem;
Function diuretic hormone activity; hormone activity; peptide hormone receptor binding; receptor binding; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPPB Products

Required fields are marked with *

My Review for All NPPB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon