Active GMP Recombinant Human CD40LG Protein

• Cat.No.: CD40LG-156HG
• Product Overview: Recombinant Human CD40LG (Met113-Leu261) was produced in HEK293 cell in an animal component free process under cGMP guidelines.

Specification

• Species: Human
• Source: HEK293
• Tag: Non
• Protein Length: 113-261 a.a.
• Description: CD40 Ligand (CD40LG) is a type II transmembrane glycoprotein that belongs to the TNF superfamily. Like other TNF superfamily members, CD40LG exists as a trimer in membrane bound and soluble form, both of which are bioactive. CD40LG is a ligand for CD40; its ligation also initiates signal transduction in CD40LG expressing cells. CD40LG is a differentiation antigen that is expressed on the surface of T-cells. It stimulates B-cell proliferation and secretion of all immunoglobulin isotypes in the presence of cytokines. CD40LG has been shown to induce cytokine production and tumoricidal activity in peripheral blood monocytes. It also co-stimulates proliferation of activated T-cells and this is accompanied by the production of IFN-gamma, TNF-alpha, and IL2.
• Form: Lyophilized.
• Bio-activity: 1x10^5U/mg
• AA Sequence: MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTF CSNREASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVT DPSQVSHGTGFTSFGLLKL
• Residual Host Cell DNA Content: <10pg/mg
• Residual Host Cell Protein Content: <1ug/mg
• Endotoxin: <0.1EU/ug
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Usage: Recommemnd working concentration: 100-1000ng/ml
• Storage: Lyophilized and reconstituted protein should be stored at -80 centigrade. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration >100μg/ml.
  Dissolve the lyophilized protein in ddH2O.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Quality Statement: Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.

Gene Information

• Gene Name: CD40LG CD40 ligand [ Homo sapiens ]
• Official Symbol: CD40LG
• Synonyms: CD40LG; CD40 ligand; CD40 antigen ligand; CD40L; CD154; gp39; hCD40L; TRAP; CD40-L; T-cell antigen Gp39; IGM; IMD3; HIGM1; T-BAM; TNFSF5
• Gene ID: 959
• mRNA Refseq: NM_000074
• Protein Refseq: NP_000065
• MIM: 300386
• UniProt ID: P29965