Active GMP Recombinant Human CD40LG Protein
Cat.No. : | CD40LG-156HG |
Product Overview : | Recombinant Human CD40LG (Met113-Leu261) was produced in HEK293 cell in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Non |
Protein Length : | 113-261 a.a. |
Description : | CD40 Ligand (CD40LG) is a type II transmembrane glycoprotein that belongs to the TNF superfamily. Like other TNF superfamily members, CD40LG exists as a trimer in membrane bound and soluble form, both of which are bioactive. CD40LG is a ligand for CD40; its ligation also initiates signal transduction in CD40LG expressing cells. CD40LG is a differentiation antigen that is expressed on the surface of T-cells. It stimulates B-cell proliferation and secretion of all immunoglobulin isotypes in the presence of cytokines. CD40LG has been shown to induce cytokine production and tumoricidal activity in peripheral blood monocytes. It also co-stimulates proliferation of activated T-cells and this is accompanied by the production of IFN-gamma, TNF-alpha, and IL2. |
Form : | Lyophilized. |
Bio-activity : | 1x10^5U/mg |
AA Sequence : | MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTF CSNREASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVT DPSQVSHGTGFTSFGLLKL |
Residual Host Cell DNA Content : | <10pg/mg |
Residual Host Cell Protein Content : | <1ug/mg |
Endotoxin : | <0.1EU/ug |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Usage : | Recommemnd working concentration: 100-1000ng/ml |
Storage : | Lyophilized and reconstituted protein should be stored at -80 centigrade. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration >100μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Quality Statement : | Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | CD40LG CD40 ligand [ Homo sapiens ] |
Official Symbol | CD40LG |
Synonyms | CD40LG; CD40 ligand; CD40 antigen ligand; CD40L; CD154; gp39; hCD40L; TRAP; CD40-L; T-cell antigen Gp39; IGM; IMD3; HIGM1; T-BAM; TNFSF5 |
Gene ID | 959 |
mRNA Refseq | NM_000074 |
Protein Refseq | NP_000065 |
MIM | 300386 |
UniProt ID | P29965 |
◆ Recombinant Proteins | ||
CD40LG-103H | Recombinant Human CD40LG Protein, Fc-tagged | +Inquiry |
CD40LG-0947H | Recombinant Human CD40LG Protein (Glu108-Leu261), C-His tagged | +Inquiry |
CD40LG-101H | Recombinant Human CD40LG Protein, His-tagged | +Inquiry |
CD40LG-5368H | Recombinant Human CD40LG protein, His-tagged | +Inquiry |
CD40LG-6298C | Recombinant Chicken CD40LG | +Inquiry |
◆ Native Proteins | ||
CD40LG-30H | Recombinant Human CD40LG Protein, Tag Free | +Inquiry |
CD40LG-30M | Recombinant Monkey CD40LG Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD40LG-1205RCL | Recombinant Rat CD40LG cell lysate | +Inquiry |
CD40LG-1548MCL | Recombinant Mouse CD40LG cell lysate | +Inquiry |
CD40LG-1080CCL | Recombinant Cynomolgus CD40LG cell lysate | +Inquiry |
CD40LG-001CCL | Recombinant Canine CD40LG cell lysate | +Inquiry |
CD40LG-1965HCL | Recombinant Human CD40LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD40LG Products
Required fields are marked with *
My Review for All CD40LG Products
Required fields are marked with *