Active GMP Recombinant Human EGF Protein

• Cat.No.: EGF-01HG
• Product Overview: GMP Recombinant Human EGF Protein(P01133)(971-1023 aa) was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Tag: Non
• Protein Length: 971-1023 aa
• Form: PBS,5% mannitol and 0.01% Tween 80, pH7.4
• Bio-activity: Measured in a cell proliferation assay using NIH3T3 mouse embryonic fibroblast Cells. The ED50 for this effect ≤0.3 ng/mL.
• Molecular Mass: 6.2 kDa
• AASequence: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
• Endotoxin: ≤10 EU/mg by the LAL method
• Purity: ≥95%, by SDS-PAGE (under reducing (R) & Non-reducing conditions, visualized by Coomassie staining)
• Storage: 36 months at -20°C to -80°C in lyophilized state; 6 months at -20°C to -80°C under sterile conditions after reconstitution; 7-10 days at 2°C to 8°C under sterile conditions after reconstitution; Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended to redissolve in sterile deionized water.

Gene Information

• Gene Name: EGF epidermal growth factor [ Homo sapiens ]
• Official Symbol: EGF
• Synonyms: EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4
• Gene ID: 1950
• mRNA Refseq: NM_001178130
• Protein Refseq: NP_001171601
• MIM: 131530
• UniProt ID: P01133