Active GMP Recombinant Human EGF Protein

Cat.No. : EGF-01HG
Product Overview : GMP Recombinant Human EGF Protein(P01133)(971-1023 aa) was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Tag : Non
Protein Length : 971-1023 aa
Form : PBS,5% mannitol and 0.01% Tween 80, pH7.4
Bio-activity : Measured in a cell proliferation assay using NIH3T3 mouse embryonic fibroblast Cells. The ED50 for this effect ≤0.3 ng/mL.
Molecular Mass : 6.2 kDa
AASequence : NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Endotoxin : ≤10 EU/mg by the LAL method
Purity : ≥95%, by SDS-PAGE (under reducing (R) & Non-reducing conditions, visualized by Coomassie staining)
Storage : 36 months at -20°C to -80°C in lyophilized state; 6 months at -20°C to -80°C under sterile conditions after reconstitution; 7-10 days at 2°C to 8°C under sterile conditions after reconstitution; Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended to redissolve in sterile deionized water.
Gene Name EGF epidermal growth factor [ Homo sapiens ]
Official Symbol EGF
Synonyms EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4;
Gene ID 1950
mRNA Refseq NM_001178130
Protein Refseq NP_001171601
MIM 131530
UniProt ID P01133

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EGF Products

Required fields are marked with *

My Review for All EGF Products

Required fields are marked with *

0
cart-icon
0
compare icon