Active GMP Recombinant Human FN1 Protein

Cat.No. : FN1-154HG
Product Overview : Recombinant Human NF1, Pro1270-Ser1546&Ala1721-Thr2016, was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 1270-1546;1721-2016 a.a.
Description : Fibronectin1(FN1) is a secreted protein and contains 12 fibronectin type-I domains,fibronectin type-II domains and 16 fibronectin type-III domains.Recombinant human fibronectin fragment, is a protein of ~63 kDa containing a central cell-binding domain, a high affinity heparin-binding domain II,and CS1 site within the alternatively spliced III CS region of human fibronectin. Cells bind to a VLA-4 ligand, a CS-I site, and a VLA-5 ligand, a cell attachment domain, and virus vectors binds to a heparin binding domain II, which co-locates the cell and the virus vector on NovoNectin. This process enhances the density of both cells and vectors, and facilitates the gene transduction in the result.
Form : Lyophilized.
Bio-activity : Measured by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells.
When 1×10E5 cells/well areadded to Fibronectin-coated plates (7-13 ng/mL and 100μL/well), approximately 50%-80% will adhere specifically after 30 minutes at 37°C.
AA Sequence : MPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTE YVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFS GRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTS LLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSP ASSKPISINYRTEIDKPSMAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMK EINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTIT ISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVV IDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATIT GLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPST
Residual Host Cell DNA Content : <10pg/mg
Residual Host Cell Protein Content : <1ug/mg
Endotoxin : <0.1EU/ug
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Lyophilized and reconstituted protein should be stored at -80 centigrade. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration >100μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Quality Statement : Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
Shipping : The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name FN1 fibronectin 1 [ Homo sapiens ]
Official Symbol FN1
Synonyms FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND
Gene ID 2335
mRNA Refseq NM_002026
Protein Refseq NP_002017
MIM 135600
UniProt ID P02751

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FN1 Products

Required fields are marked with *

My Review for All FN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon