Active GMP Recombinant Human FN1 Protein
Cat.No. : | FN1-154HG |
Product Overview : | Recombinant Human NF1, Pro1270-Ser1546&Ala1721-Thr2016, was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1270-1546;1721-2016 a.a. |
Description : | Fibronectin1(FN1) is a secreted protein and contains 12 fibronectin type-I domains,fibronectin type-II domains and 16 fibronectin type-III domains.Recombinant human fibronectin fragment, is a protein of ~63 kDa containing a central cell-binding domain, a high affinity heparin-binding domain II,and CS1 site within the alternatively spliced III CS region of human fibronectin. Cells bind to a VLA-4 ligand, a CS-I site, and a VLA-5 ligand, a cell attachment domain, and virus vectors binds to a heparin binding domain II, which co-locates the cell and the virus vector on NovoNectin. This process enhances the density of both cells and vectors, and facilitates the gene transduction in the result. |
Form : | Lyophilized. |
Bio-activity : | Measured by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. When 1×10E5 cells/well areadded to Fibronectin-coated plates (7-13 ng/mL and 100μL/well), approximately 50%-80% will adhere specifically after 30 minutes at 37°C. |
AA Sequence : | MPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTE YVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFS GRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTS LLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSP ASSKPISINYRTEIDKPSMAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMK EINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTIT ISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVV IDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATIT GLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPST |
Residual Host Cell DNA Content : | <10pg/mg |
Residual Host Cell Protein Content : | <1ug/mg |
Endotoxin : | <0.1EU/ug |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized and reconstituted protein should be stored at -80 centigrade. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration >100μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Quality Statement : | Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | FN1 fibronectin 1 [ Homo sapiens ] |
Official Symbol | FN1 |
Synonyms | FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND |
Gene ID | 2335 |
mRNA Refseq | NM_002026 |
Protein Refseq | NP_002017 |
MIM | 135600 |
UniProt ID | P02751 |
◆ Recombinant Proteins | ||
FN1-3033H | Recombinant Human FN1 Protein (Gly313-Ser607), His tagged | +Inquiry |
FN1-5000HF | Recombinant Full Length Human FN1 Protein, GST-tagged | +Inquiry |
FN1-1811H | Recombinant Human FN1 protein, GST-tagged | +Inquiry |
FN1-107H | Recombinant Human Fibronectin III 8-10, 13, GST-tagged | +Inquiry |
FN1-882H | Active Recombinant Human FN1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FN1-2708HB | Native Human Fibronectin Protein, Biotinylated | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
FN1-701H | Native Human Fibronectin 1 | +Inquiry |
FN1-3B | Active Bovine Fibronectin, carrier free | +Inquiry |
Fibronectin-13R | Native Rat Fibronectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FN1-2956HCL | Recombinant Human FN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FN1 Products
Required fields are marked with *
My Review for All FN1 Products
Required fields are marked with *
0
Inquiry Basket