| Species : | 
                                    Human | 
                                
                                
                                    | Source : | 
                                    E.coli | 
                                
                                
                                    | Tag : | 
                                    Non | 
                                
                                
                                    | Description : | 
                                    Interleukin-10 (IL-10), also known as cytokine synthesis inhibitory factor (CSIF), is the charter member of the IL-10 family of α-helical cytokines that also includes IL-19, IL-20, IL-22, IL-24, and IL-26/AK155. IL-10 is secreted by many activated hematopoietic cell types as well as hepatic stellate cells, keratinocytes, and placental cytotrophoblasts. Whereas human IL-10 is active on mouse cells, mouse IL-10 does not act on human cells. IL-10 is a 178 amino acid molecule that contains two intrachain disulfide bridges and is expressed as a 36 kDa noncovalently associated homodimer. The IL-10 dimer binds to two IL-10 Rα/IL-10R1 chains, resulting in recruitment of two IL-10 Rβ/IL-10R2 chains and activation of a signaling cascade involving JAK1, TYK2, and STAT3. IL-10Rβ does not bind IL-10 by itself but is required for signal transduction. IL-10 is a critical molecule in the control of viral infections and allergic and autoimmune inflammation. It promotes phagocytic uptake and Th2 responses but suppresses antigen presentation and Th1 proinflammatory responses. | 
                                
                                
                                    | Form : | 
                                    Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. | 
                                
                                
                                    | Bio-activity : | 
                                    Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine MC/9-2 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 10^6 IU/mg. | 
                                
                                
                                    | Molecular Mass : | 
                                    Approximately 18.6 kDa, a single non-glycosylated polypeptide chain containing 160 amino acids. | 
                                
                                
                                    | AA Sequence : | 
                                    SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN | 
                                
                                
                                    | Endotoxin : | 
                                    Less than 1 EU/µg of rHuIL-10 as determined by LAL method. | 
                                
                                
                                    | Purity : | 
                                    > 95 % by SDS-PAGE and HPLC analyses. | 
                                
                                
                                    | Storage : | 
                                    This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles. | 
                                
                                
                                    | Reconstitution : | 
                                    Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. | 
                                
                                
                                    | Quality Statement : | 
                                    Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. | 
                                
                                
                                    | Shipping : | 
                                    The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |