Active GMP Recombinant Human VEGFA Protein
| Cat.No. : | VEGFA-01HG |
| Product Overview : | Active GMP Recombinant Human VEGFA Protein(P15692)(27-191 aa) was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | CHO |
| Tag : | Non |
| Protein Length : | 27-191 aa |
| Form : | PBS, 5% mannitol and 0.01% Tween 80, pH 7.4 |
| Bio-activity : | Measured in a cell proliferation assay using HUVEC human umbilicveinendothelial cells. The ED50 for this effect is 0.2-5 ng/mL. |
| Molecular Mass : | 19.1kDa |
| AASequence : | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Endotoxin : | ≤10 EU/mg by the LAL method |
| Purity : | ≥95%, by SDS-PAGE (under reducing (R) & Non-reducing conditions, visualized by Coomassie staining) |
| Storage : | 36 months at -20°C to -80°C in lyophilized state 6 months at -20°C to -80°C under sterile conditions after reconstitution 7-10 days at 2°C to 8°C under sterile conditions after reconstitution Use a manual defrost freezer and avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended to redissolve in sterile deionized water. |
| Gene Name | VEGFA vascular endothelial growth factor A [ Homo sapiens ] |
| Official Symbol | VEGFA |
| Synonyms | VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor , VEGF; VEGF A; VPF; vascular permeability factor; VEGF; MVCD1; MGC70609; |
| Gene ID | 7422 |
| mRNA Refseq | NM_001025366 |
| Protein Refseq | NP_001020537 |
| UniProt ID | P15692 |
| ◆ Recombinant Proteins | ||
| VEGFA-959C | Recombinant Canine VEGFA protein(Met1-Arg190) | +Inquiry |
| VEGFA-136C | Active Recombinant Human/Cynomolgus VEGF165 protein (Met1-Arg191) | +Inquiry |
| Vegfa-015V | Active Recombinant Mouse VEGF120 Protein (121 aa) | +Inquiry |
| VEGFA-7310HAF647 | Recombinant Human VEGFA Protein, None-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| VEGFA-302C | Recombinant Canine VEGFA, None tagged | +Inquiry |
| ◆ Native Proteins | ||
| VEGFA-31701TH | Native Human VEGFA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VEGFA-647MCL | Recombinant Mouse VEGFA cell lysate | +Inquiry |
| VEGFA-522RCL | Recombinant Rat VEGFA cell lysate | +Inquiry |
| VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
| VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-655HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *
