Active GMP Recombinant Mouse Ccl2 Protein, His-Tagged

Cat.No. : Ccl2-01M
Product Overview : GMP Recombinant Mouse Ccl2 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : This gene is one of several cytokine genes clustered on chromosome 11. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes and memory T cells but not for neutrophils. The human ortholog has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis, and atherosclerosis.
Form : Lyophilized
Bio-activity : Measure by its ability to chemoattract BaF3 cells transfected with CCR2A. The ED50 for this effect is <8 ng/mL.
AA Sequence : QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLN
VKLTRKSEANASTTFSTTTSSTSVGVTSVTVN with polyhistidine tag at the N-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name Ccl2 chemokine (C-C motif) ligand 2 [ Mus musculus (house mouse) ]
Official Symbol Ccl2
Synonyms Mip1a; Scya3; G0S19-1; MIP1-(a); LD78alpha; MIP-1alpha; MIP1-alpha
Gene ID 20296
mRNA Refseq NM_011333.3
Protein Refseq NP_035463.1
UniProt ID P10148

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl2 Products

Required fields are marked with *

My Review for All Ccl2 Products

Required fields are marked with *

0
cart-icon
0
compare icon