| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
This gene is one of several cytokine genes clustered on chromosome 11. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes and memory T cells but not for neutrophils. The human ortholog has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis, and atherosclerosis. |
| Form : |
Lyophilized |
| Bio-activity : |
Measure by its ability to chemoattract BaF3 cells transfected with CCR2A. The ED50 for this effect is <8 ng/mL. |
| AA Sequence : |
QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLN
VKLTRKSEANASTTFSTTTSSTSVGVTSVTVN with polyhistidine tag at the N-terminus |
| Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Purity : |
>98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Notes : |
Please use within one month after protein reconstitution. |
| Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Storage Buffer : |
The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
