| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
Predicted to enable CXCR chemokine receptor binding activity and chemokine activity. Predicted to be involved in several processes, including cellular response to lipopolysaccharide; chemokine-mediated signaling pathway; and neutrophil chemotaxis. Predicted to be active in extracellular space. Is expressed in head; nasal cavity epithelium; palatal shelf epithelium; palatal shelf mesenchyme; and testis. Orthologous to human CXCL11 (C-X-C motif chemokine ligand 11). |
| Form : |
Lyophilized |
| Bio-activity : |
Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is <10 ng/mL. |
| AA Sequence : |
FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM with polyhistidine tag at the N-terminus |
| Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Purity : |
>98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Notes : |
Please use within one month after protein reconstitution. |
| Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Storage Buffer : |
The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
