Active GMP Recombinant Mouse Cxcl11 Protein, His-Tagged

Cat.No. : Cxcl11-01M
Product Overview : GMP Recombinant Mouse Cxcl11 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Predicted to enable CXCR chemokine receptor binding activity and chemokine activity. Predicted to be involved in several processes, including cellular response to lipopolysaccharide; chemokine-mediated signaling pathway; and neutrophil chemotaxis. Predicted to be active in extracellular space. Is expressed in head; nasal cavity epithelium; palatal shelf epithelium; palatal shelf mesenchyme; and testis. Orthologous to human CXCL11 (C-X-C motif chemokine ligand 11).
Form : Lyophilized
Bio-activity : Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is <10 ng/mL.
AA Sequence : FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM with polyhistidine tag at the N-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name Cxcl11 chemokine (C-X-C motif) ligand 11 [ Mus musculus (house mouse) ]
Official Symbol Cxcl11
Synonyms Ip9; H174; Itac; b-R1; Cxc11; I-tac; Scyb11; Scyb9b; betaR1
Gene ID 56066
mRNA Refseq NM_019494.1
Protein Refseq NP_062367.1
UniProt ID Q9JHH5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcl11 Products

Required fields are marked with *

My Review for All Cxcl11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon