Active GMP Recombinant Mouse Cxcl11 Protein, His-Tagged

• Cat.No.: Cxcl11-01M
• Product Overview: GMP Recombinant Mouse Cxcl11 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Predicted to enable CXCR chemokine receptor binding activity and chemokine activity. Predicted to be involved in several processes, including cellular response to lipopolysaccharide; chemokine-mediated signaling pathway; and neutrophil chemotaxis. Predicted to be active in extracellular space. Is expressed in head; nasal cavity epithelium; palatal shelf epithelium; palatal shelf mesenchyme; and testis. Orthologous to human CXCL11 (C-X-C motif chemokine ligand 11).
• Form: Lyophilized
• Bio-activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is <10 ng/mL.
• AA Sequence: FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: Cxcl11 chemokine (C-X-C motif) ligand 11 [ Mus musculus (house mouse) ]
• Official Symbol: Cxcl11
• Synonyms: Ip9; H174; Itac; b-R1; Cxc11; I-tac; Scyb11; Scyb9b; betaR1
• Gene ID: 56066
• mRNA Refseq: NM_019494.1
• Protein Refseq: NP_062367.1
• UniProt ID: Q9JHH5