Active GMP Recombinant Mouse Cxcl9 Protein, His-Tagged
Cat.No. : | Cxcl9-01M |
Product Overview : | GMP Recombinant Mouse Cxcl9 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Predicted to enable CXCR3 chemokine receptor binding activity and chemokine activity. Acts upstream of or within several processes, including defense response to virus; positive regulation of myoblast differentiation; and positive regulation of myoblast fusion. Located in external side of plasma membrane and extracellular space. Is expressed in central nervous system; retina; stomach; testis; and thymus. Orthologous to human CXCL9 (C-X-C motif chemokine ligand 9). |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to chemoattract BaF3 cells transfected with mouse CXCR3. The ED50 for this effect is <0.3 μg/mL. |
AA Sequence : | TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKP KTPQSRRRSRKTT with polyhistidine tag at the N-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | Cxcl9 chemokine (C-X-C motif) ligand 9 [ Mus musculus (house mouse) ] |
Official Symbol | Cxcl9 |
Synonyms | CMK; Mig; MuMIG; Scyb9; crg-10 |
Gene ID | 17329 |
mRNA Refseq | NM_008599.4 |
Protein Refseq | NP_032625.2 |
UniProt ID | P18340 |
◆ Recombinant Proteins | ||
CXCL9-143E | Recombinant Equine Chemokine (C-X-C motif) Ligand 9 | +Inquiry |
CXCL9-113H | Recombinant Human CXCL9 Protein, His-tagged | +Inquiry |
CXCL9-219H | Active Recombinant Human CXCL9 Protein (Thr21-Thr125), N-His tagged, Animal-free, Carrier-free | +Inquiry |
CXCL9-2175H | Recombinant Human CXCL9 Protein, GST-tagged | +Inquiry |
CXCL9-1112R | Recombinant Rhesus monkey CXCL9 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL9-7165HCL | Recombinant Human CXCL9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcl9 Products
Required fields are marked with *
My Review for All Cxcl9 Products
Required fields are marked with *
0
Inquiry Basket