Active GMP Recombinant Mouse Ngf Protein, His-Tagged

Cat.No. : Ngf-01M
Product Overview : GMP Recombinant Mouse Ngf Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Enables transmembrane receptor protein tyrosine kinase activator activity. Involved in positive regulation of DNA binding activity; positive regulation of Ras protein signal transduction; and positive regulation of protein phosphorylation. Acts upstream of or within several processes, including cell surface receptor signaling pathway; positive regulation of cell projection organization; and positive regulation of macromolecule metabolic process. Located in neuron projection terminus. Is expressed in several structures, including alimentary system; genitourinary system; limb; nervous system; and sensory organ. Human ortholog(s) of this gene implicated in several diseases, including IgA glomerulonephritis; end stage renal disease; hereditary sensory and autonomic neuropathy type 5; interstitial cystitis; and neurogenic bladder. Orthologous to human NGF (nerve growth factor).
Form : Lyophilized
Bio-activity : Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant mouse beta-NGF is > 1 x 10^6 IU/mg.
AA Sequence : MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name Ngf nerve growth factor [ Mus musculus (house mouse) ]
Official Symbol Ngf
Synonyms Ngfb; beta-NGF
Gene ID 18049
mRNA Refseq NM_001112698.2
Protein Refseq NP_001106168.1
UniProt ID P01139

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ngf Products

Required fields are marked with *

My Review for All Ngf Products

Required fields are marked with *

0

Inquiry Basket

cartIcon