Recombinant Human Pro-Nerve Growth Factor
Cat.No. : | NGF-11H |
Product Overview : | Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer. Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 222 amino acids and having a molecular mass of 49,738 Dalton. The Pro NGF is purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Physical Appearance : | Sterile Filtered clear solution. |
Amino acid sequence : | MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKK RRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSV SVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNS YCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAR. |
Purity : | Greater than 98.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Formulation : | The sterile protein solution 1.2mg/ml contains 50mM sodium phosphate buffer pH 7.2. 150mM sodium chloride. |
Biological Activity : | The activity of the protein can by measured by its stimulating effect on the proliferation of TF1 cells (Chevalier et al. 1994 Blood 83, 1479-85). EC50 130 ± 30 pM (TF1 cell assay). |
Storage : | Pro-Nerve Growth Factor although stable at 15℃ for a week, should be stored at -20℃. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Synonyms | Human Pro-NGF; ProNGF; Pro-Nerve Growth Factor. |
◆ Recombinant Proteins | ||
NGF-1155H | Recombinant Horse NGF Protein, His-tagged | +Inquiry |
Ngf-5426M | Recombinant Mouse Ngf Protein (Ser122-Ala241) | +Inquiry |
NGF-1314H | Recombinant Human NGF Protein (Ser122-Arg239) | +Inquiry |
NGF-002H | Active Recombinant Human NGF, MIgG2a Fc-tagged | +Inquiry |
NGF-29561TH | Recombinant Human NGF | +Inquiry |
◆ Native Proteins | ||
Ngf-51M | Native Mouse Nerve Growth Factor 2.5S | +Inquiry |
Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGF-001HCL | Recombinant Human NGF cell lysate | +Inquiry |
NGF-001MCL | Recombinant Mouse NGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NGF Products
Required fields are marked with *
My Review for All NGF Products
Required fields are marked with *