Active GMP Recombinant Mouse Vegfa 165 Protein, His-Tagged

Cat.No. : Vegfa-02M
Product Overview : GMP Recombinant Mouse Vegfa 165 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site.
Form : Lyophilized
Bio-activity : Measure by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is <3 ng/mL.
AA Sequence : MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography.
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name Vegfa vascular endothelial growth factor A [ Mus musculus (house mouse) ]
Official Symbol Vegfa
Synonyms VPF; VEGF; MVCD1
Gene ID 22339
mRNA Refseq NM_001025250.3
Protein Refseq NP_001020421.2
UniProt ID Q00731

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Vegfa Products

Required fields are marked with *

My Review for All Vegfa Products

Required fields are marked with *

0
cart-icon