Active Recombinant Human VEGF165 Protein (165 aa)

Cat.No. : VEGFA-144V
Product Overview : Recombinant Human VEGF165 Protein (165 aa) without tag was expressed in P. pastoris.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : P.pastoris
Protein Length : 165
Description : Vascular Endothelial Growth Factor (VEGF) is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, Vascular Endothelial Growth Factor (VEGF) plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates Vascular Endothelial Growth Factor (VEGF) in the induction of tumor metastasis and intra-ocular neovascular syndromes. Vascular Endothelial Growth Factor (VEGF) signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 of 1-5 ng/mL, measured by the dose-dependent stimulation of the proliferation of HUVEC cells, corresponding to a specific activity of 2 × 10^5 to 1 × 10^6 units/mg.
Molecular Mass : 38.2kDa, observed by non-reducing SDS-PAGE
AA Sequence : APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Endotoxin : < 0.5 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by reducing SDS-PAGE.
Storage : Lyophilized recombinant human Vascular Endothelial Growth Factor A165 (rhVEGF-A165) remains stable up to 12 months at -80 centigrade from date of receipt. Upon reconstitution, rhVEGF-A165 should be stable up to 4 week at 4 centigrade or up to 6 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 25 mM HEPES and 150 mM NaCl, pH 7.0.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name VEGFA vascular endothelial growth factor A [ Homo sapiens ]
Official Symbol VEGFA
Synonyms VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor, VEGF; VEGF A; VPF; vascular permeability factor; VEGF; MVCD1; MGC70609;
Gene ID 7422
mRNA Refseq NM_001025366
Protein Refseq NP_001020537
MIM 192240
UniProt ID P15692

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VEGFA Products

Required fields are marked with *

My Review for All VEGFA Products

Required fields are marked with *

0
cart-icon