Active GMP Recombinant Porcine CSF2 Protein, His-Tagged

Cat.No. : CSF2-01P
Product Overview : GMP Recombinant Porcine CSF2 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Porcine
Source : E.coli
Tag : His
Description : Granulocyte-macrophage colony-stimulating factor (GM-CSF), also known as colony-stimulating factor 2 (CSF2), is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, natural killer cells, endothelial cells and fibroblasts that functions as a cytokine. GM-CSF also plays a role in embryonic development by functioning as an embryokine produced by reproductive tract.
Form : Lyophilized
Bio-activity : Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <3 ng/mL.
AA Sequence : APTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK with polyhistidine tag at the N-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name CSF2 colony stimulating factor 2 [ Sus scrofa (pig) ]
Official Symbol CSF2
Synonyms GM-CSF
Gene ID 397208
mRNA Refseq NM_214118.2
Protein Refseq NP_999283.1
UniProt ID Q29118

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSF2 Products

Required fields are marked with *

My Review for All CSF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon