Active GMP Recombinant Porcine CXCL10 Protein, His-Tagged

Cat.No. : CXCL10-01P
Product Overview : GMP Recombinant Porcine CXCL10 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Porcine
Source : E.coli
Tag : His
Description : CXCL10 ,belongs to the CXC chemokine family, is also known as IP-10. CXCL10 was originally identified as a responsor to IFN-gamma in monocytes, endothelial cells and fibroblasts. The effects of this chemokine can be induced by binding to the cell surface chemokine receptor CXCR3. Research shows that CXCL10 is a chemoattractant for activated T-lymphocytes, monocytes and macrophages. It also has other functions, such as promotion of T cell adhesion to endothelial cell.
Form : Lyophilized
Bio-activity : Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <4 ng/mL.
AA Sequence : PLSRTVRCTCIKISDRPVNPRSLEKLEMIPASQSCPHVEIIATMKKNGEKRCLNPESKTIKNLLKAISKERSKRSPRTQREA with polyhistidine tag at the N-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name CXCL10 C-X-C motif chemokine ligand 10 [ Sus scrofa (pig) ]
Official Symbol CXCL10
Gene ID 494019
mRNA Refseq NM_001008691.1
Protein Refseq NP_001008691.1
UniProt ID A0A4X1SX64

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL10 Products

Required fields are marked with *

My Review for All CXCL10 Products

Required fields are marked with *

0
cart-icon