Active GMP Recombinant Porcine CXCL10 Protein, His-Tagged
Cat.No. : | CXCL10-01P |
Product Overview : | GMP Recombinant Porcine CXCL10 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine |
Source : | E.coli |
Tag : | His |
Description : | CXCL10 ,belongs to the CXC chemokine family, is also known as IP-10. CXCL10 was originally identified as a responsor to IFN-gamma in monocytes, endothelial cells and fibroblasts. The effects of this chemokine can be induced by binding to the cell surface chemokine receptor CXCR3. Research shows that CXCL10 is a chemoattractant for activated T-lymphocytes, monocytes and macrophages. It also has other functions, such as promotion of T cell adhesion to endothelial cell. |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <4 ng/mL. |
AA Sequence : | PLSRTVRCTCIKISDRPVNPRSLEKLEMIPASQSCPHVEIIATMKKNGEKRCLNPESKTIKNLLKAISKERSKRSPRTQREA with polyhistidine tag at the N-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | CXCL10 C-X-C motif chemokine ligand 10 [ Sus scrofa (pig) ] |
Official Symbol | CXCL10 |
Gene ID | 494019 |
mRNA Refseq | NM_001008691.1 |
Protein Refseq | NP_001008691.1 |
UniProt ID | A0A4X1SX64 |
◆ Recombinant Proteins | ||
CXCL10-70H | Recombinant Human CXCL10 (IP-10) | +Inquiry |
Cxcl10-2774H | Recombinant Hamster Cxcl10 Protein, His-tagged | +Inquiry |
CXCL10-050H | Recombinant Human CXCL10 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CXCL10-86R | Recombinant Rat CXCL10 | +Inquiry |
CXCL10-31H | Recombinant Human CXCL10, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL10-7172HCL | Recombinant Human CXCL10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL10 Products
Required fields are marked with *
My Review for All CXCL10 Products
Required fields are marked with *
0
Inquiry Basket