Active GMP Recombinant Porcine IL2 Protein, His-Tagged

• Cat.No.: IL2-01P
• Product Overview: GMP Recombinant Porcine IL2 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Porcine
• Source: E.coli
• Tag: His
• Description: Interleukin-2 (IL-2) is an interleukin, a type of cytokine signaling molecule in the immune system. It is a 15,5 - 16 kDa protein that regulates the activities of white blood cells (leukocytes, often lymphocytes) that are responsible for immunity. IL-2 is part of the body's natural response to microbial infection, and in discriminating between foreign ("non-self") and "self". IL-2 mediates its effects by binding to IL-2 receptors, which are expressed by lymphocytes.
• Form: Lyophilized
• Bio-activity: Measure by its ability to induce proliferation in CTLL2 cells. The ED50 for this effect is <0.5 ng/mL.
• AA Sequence: MAPTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKGSETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: IL2 interleukin 2 [ Sus scrofa (pig) ]
• Official Symbol: IL2
• Synonyms: IL-2; TCGF; POIL2
• Gene ID: 396868
• mRNA Refseq: NM_213861.1
• Protein Refseq: NP_999026.1
• UniProt ID: P26891