Active GMP Recombinant Porcine IL2 Protein, His-Tagged
Cat.No. : | IL2-01P |
Product Overview : | GMP Recombinant Porcine IL2 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine |
Source : | E.coli |
Tag : | His |
Description : | Interleukin-2 (IL-2) is an interleukin, a type of cytokine signaling molecule in the immune system. It is a 15,5 - 16 kDa protein that regulates the activities of white blood cells (leukocytes, often lymphocytes) that are responsible for immunity. IL-2 is part of the body's natural response to microbial infection, and in discriminating between foreign ("non-self") and "self". IL-2 mediates its effects by binding to IL-2 receptors, which are expressed by lymphocytes. |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to induce proliferation in CTLL2 cells. The ED50 for this effect is <0.5 ng/mL. |
AA Sequence : | MAPTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKGSETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | IL2 interleukin 2 [ Sus scrofa (pig) ] |
Official Symbol | IL2 |
Synonyms | IL-2; TCGF; POIL2 |
Gene ID | 396868 |
mRNA Refseq | NM_213861.1 |
Protein Refseq | NP_999026.1 |
UniProt ID | P26891 |
◆ Recombinant Proteins | ||
IL2-635C | Recombinant Cattle IL2 protein, His & T7-tagged | +Inquiry |
IL2-68H | Recombinant Human IL-2 | +Inquiry |
IL2-196P | Active Recombinant Pig IL2 Protein (Ala21-Thr154), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL2-464H | Active Recombinant Human Interleukin 2 | +Inquiry |
IL2-3100R | Recombinant Rabbit IL2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2-5234HCL | Recombinant Human IL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL2 Products
Required fields are marked with *
My Review for All IL2 Products
Required fields are marked with *
0
Inquiry Basket