Active GMP Recombinant Porcine IL6 Protein, His-Tagged

Cat.No. : IL6-01P
Product Overview : GMP Recombinant Porcine IL6 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Porcine
Source : E.coli
Tag : His
Description : Interleukin 6 (IL-6) is an interleukin that acts as both a pro-inflammatory cytokine and an anti-inflammatory myokine. In humans, it is encoded by the IL6 gene. In addition, osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. IL-6's role as an anti-inflammatory myokine is mediated through its inhibitory effects on TNF-alpha and IL-1, and activation of IL-1ra and IL-10.
Form : Lyophilized
Bio-activity : Measure by its ability to induce proliferation in T1165.85.2.1 cells. The ED50 for this effect is <1.5 ng/mL.
AA Sequence : MGRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name IL6 interleukin 6 [ Sus scrofa (pig) ]
Official Symbol IL6
Gene ID 399500
mRNA Refseq NM_214399.1
Protein Refseq NP_999564.1
UniProt ID P26893

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL6 Products

Required fields are marked with *

My Review for All IL6 Products

Required fields are marked with *

0
cart-icon
0
compare icon