Active Recombinant Canine CSF2 Protein

Cat.No. : CSF2-43C
Product Overview : Recombinant Canine CSF2 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Canine
Source : E.coli
Description : Granulocyte-macrophage colony-stimulating factor (GM-CSF) is a hematopoietic growth factor produced by endothelial cells, monocytes, fibroblasts, and T cells, GM-CSF stimulates the production of neutrophilic granulocytes, macrophages, and mixed granulocyte-macrophage colonies from bone marrow cells, GM-CSF promotes immune system development and regulates neutrophil function during infection.
Bio-activity : TF-1 cell proliferation, ED50≤15 ng/mL
Molecular Mass : Monomer, 14.4 kDa (with 128 amino acids)
AA Sequence : MAPTRSPTLVTRPSQHVDAIQEALSLLNNSNDVTAVMNKAVKVVSEVFDPEGPTCLETRLQLYKEGLQGSLTSLKNPLTMMANHYKQHCPPTPESPCATQNINFKSFKENLKDFLFNIPFDCWKPVKK
Endotoxin : ≤1 EUs/μg, Kinetic LAL (50% confidence)
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20‚ centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name CSF2 colony stimulating factor 2 (granulocyte-macrophage) [ Canis lupus familiaris (dog) ]
Official Symbol CSF2
Synonyms CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; CSF; colony-stimulating factor; GM-CSF;
Gene ID 403923
mRNA Refseq NM_001003245
Protein Refseq NP_001003245
UniProt ID P48749

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CSF2 Products

Required fields are marked with *

My Review for All CSF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon