Active Recombinant E. coli mCherry Protein, His-tagged
Cat.No. : | mCherry-02E |
Product Overview : | Purified fluorescent protein mCherry, with N-terminal HIS tag, expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
Description : | mCherry is derived from proteins originally isolated from Cnidarians (jelly fish, sea anemones and corals), and is used as a fluorescent tracer in trasfection and transgenic experiments. The prototype for these fluorescent proteins is Green Fluorescent Protein (GFP), which is a ~27kDa protein isolated originally from the jellyfish Aequoria victoria. The mCherry protein is derived from DsRed, a red fluorescent protein related to GFP isolated from so-called disc corals of the genus Discosoma. |
Bio-activity : | WB standard. |
Molecular Mass : | 26.5 kDa |
AA Sequence : | MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 µg/mL as determined by microplate BCA method |
Storage Buffer : | PBS, pH7.4, 10% glycerol. |
◆ Recombinant Proteins | ||
mCherry-006E | Recombinant mCherry Fluorescent Protein, His tagged | +Inquiry |
mCherry-2937A | Recombinant Anaplasma marginale mCherry protein, His-tagged | +Inquiry |
mCherry-1645A | Recombinant Anaplasma marginale mCherry Protein (Met1-Lys236), N-His tagged | +Inquiry |
mCherry-02E | Active Recombinant E. coli mCherry Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All mCherry Products
Required fields are marked with *
My Review for All mCherry Products
Required fields are marked with *
0
Inquiry Basket