Recombinant mCherry Fluorescent Protein, His tagged
| Cat.No. : | mCherry-006E |
| Product Overview : | Recombinant mCherry Fluorescent Protein with His tag was expressed in E. coli. |
| Availability | November 17, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Tag : | His |
| Description : | mCherry is a bright red monomeric fluorescent protein created by rounds of directed evolution of DsRed. mCherry matures rapidly, making it possible to see results very soon after transfection or activation of transcription. It is highly photostable and resistant to photobleaching. |
| Molecular Mass : | The protein has a calculated MW of 29 kDa. |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK |
| Endotoxin : | < 1 EU/μg |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 3.4 mg/mL |
| Storage Buffer : | PBS, pH 7.4, 10% Glycerol |
| Publications : |
Intravenous administration of blood–brain barrier-crossing conjugates facilitate biomacromolecule transport into central nervous system (2024)
|
| Official Symbol | mCherry |
| Synonyms | mCherry; mCherry Fluorescent |
| ◆ Recombinant Proteins | ||
| mCherry-02E | Active Recombinant E. coli mCherry Protein, His-tagged | +Inquiry |
| mCherry-006E | Recombinant mCherry Fluorescent Protein, His tagged | +Inquiry |
| mCherry-2937A | Recombinant Anaplasma marginale mCherry protein, His-tagged | +Inquiry |
| mCherry-1645A | Recombinant Anaplasma marginale mCherry Protein (Met1-Lys236), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All mCherry Products
Required fields are marked with *
My Review for All mCherry Products
Required fields are marked with *
