"mCherry" Related Products

Recombinant mCherry Fluorescent Protein, His-tagged

Cat.No.: mCherry-006E
Product Overview: mCherry is the second generation monomeric red fluorescent protein that have improved brightness and photostability. The recombinant mCherry is expressed and purified from transformed E. coli using a method that ensures high purity and maximal fluorescence intensity. The protein is a 28.8 kDa monomer with 256 amino acids, pI: 6.23. Ex.= 587 nm (540-590 nm); Em.= 610 nm (550-650 nm). The protein is engineered with 6xHis-tag on the N-terminus, which can be used for detection with anti-His-Tag antibody or protein purification/removal by using Ni++ beads.
Fluorescent protein ideal for subcellular labeling/visualization
Description: mCherry is a bright red monomeric fluorescent protein created by rounds of directed evolution of DsRed. mCherry matures rapidly, making it possible to see results very soon after transfection or activation of transcription. It is highly photostable and resistant to photobleaching.
Source: E. coli
Species: E. coli
Tag : His
Form: Lyophilized (Freeze Dried)
Molecular Mass: 28.8 kDa
AA Sequence: MGSSHHHHHHSSGLVPRGSHMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
Endotoxin: <0.1 ng/μg
Purity: >97% by SDS-PAGE and HPLC
Applications: The protein is suitable as a positive control for mCherry protein expression studies or as a labeling reagent. Applications include: Use as standards for SDS-PAGE, Western blot analysis of mCherry transfected cells, label other proteins or antibodies, calibration of fluorometers and flow cytometers, fluorescence microscope, or microinjection of mCherry protein into cells and tissues, etc. The recombinant mCherry protein is ideal for fusion tag applications and is perfect for triple labeling with EGFP, CFP, YFP, or any other dyes. The 6 × His-Tag on the N-terminal can be used in Western blot detection with 6 × His-tag antibodies. The 6 × Histag can also be used in removal or purification of the mCherry protein.
Usage: For Research Use Only! Not to be used in humans
Storage: At -20 centigrade.
At -80 centigrade for long-term storage.
Reconstitution: Reconstitute with dH₂O to 1 mg/mL
Handling: Centrifuge the vial prior to opening.
Synonyms: mCherry
Products Types

◆ Assay kits

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.