Recombinant mCherry Fluorescent Protein, His tagged

Cat.No. : mCherry-006E
Product Overview : Recombinant mCherry Fluorescent Protein with His tag was expressed in E. coli.
Availability May 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E.coli
Tag : His
Description : mCherry is a bright red monomeric fluorescent protein created by rounds of directed evolution of DsRed. mCherry matures rapidly, making it possible to see results very soon after transfection or activation of transcription. It is highly photostable and resistant to photobleaching.
Molecular Mass : The protein has a calculated MW of 29 kDa.
AA Sequence : MGSSHHHHHHSSGLVPRGSHMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
Endotoxin : < 1 EU/μg
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 3.4 mg/mL
Storage Buffer : PBS, pH 7.4, 10% Glycerol
Publications :
Intravenous administration of blood–brain barrier-crossing conjugates facilitate biomacromolecule transport into central nervous system (2024)
Official Symbol mCherry
Synonyms mCherry; mCherry Fluorescent

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All mCherry Products

Required fields are marked with *

My Review for All mCherry Products

Required fields are marked with *

0

Inquiry Basket

cartIcon