Active Recombinant Full Length Human AKT2 Protein, C-Flag-tagged
Cat.No. : | AKT2-260HFL |
Product Overview : | Recombinant Full Length Human AKT2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains, which is involved in signaling pathways. The gene serves as an oncogene in the tumorigenesis of cancer cells For example, its overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins, and has also been implicated in insulin signaling. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | AKT2 activity verified in a biochemical assay: AKT2 (v-akt murine thymoma viral oncogene homolog 2) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. AKT2 is a serine/threonine kinase that plays a key in regulating cell survival, insulin signaling, angiogenesis and tumor formation. Varying concentrations of AKT2 were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “ΔR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors. |
Molecular Mass : | 55.6 kDa |
AA Sequence : | MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRP NTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAV SKARAKVTMNDFDYLKLLGKGTFGRVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHP FLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLEN LMLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPF YNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase |
Protein Pathways : | Acute myeloid leukemia, Adipocytokine signaling pathway, Apoptosis, B cell receptor signaling pathway, Chemokine signaling pathway, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Glioma, Insulin signaling pathway, Jak-STAT signaling pathway, MAPK signaling pathway, Melanoma, mTOR signaling pathway, Neurotrophin signaling pathway, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Progesterone-mediated oocyte maturation, Prostate cancer, Renal cell carcinoma, Small cell lung cancer, T cell receptor signaling pathway, Tight junction, Toll-like receptor signaling pathway, VEGF signaling pathway |
Full Length : | Full L. |
Gene Name | AKT2 AKT serine/threonine kinase 2 [ Homo sapiens (human) ] |
Official Symbol | AKT2 |
Synonyms | PKBB; PRKBB; HIHGHH; PKBBETA; RAC-BETA |
Gene ID | 208 |
mRNA Refseq | NM_001626.6 |
Protein Refseq | NP_001617.1 |
MIM | 164731 |
UniProt ID | P31751 |
◆ Recombinant Proteins | ||
AKT2-262R | Recombinant Rat AKT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKT2-166H | Recombinant Human AKT2, His-tagged | +Inquiry |
AKT2-0083H | Recombinant Human AKT2 Protein (N2-E481), GST tagged | +Inquiry |
AKT2-0082H | Recombinant Human AKT2 Protein (N2-E481), Tag Free | +Inquiry |
AKT2-985H | Recombinant Human V-Akt Murine Thymoma Viral Oncogene Homolog 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKT2-8927HCL | Recombinant Human AKT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKT2 Products
Required fields are marked with *
My Review for All AKT2 Products
Required fields are marked with *
0
Inquiry Basket