Active Recombinant Full Length Human CD70 Protein, C-Flag-tagged
Cat.No. : | CD70-375HFL |
Product Overview : | Recombinant Full Length Human CD70 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | In vitro binding assay |
Molecular Mass : | 20.9 kDa |
AA Sequence : | MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQD PRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSI SLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways : | Cytokine-cytokine receptor interaction |
Full Length : | Full L. |
Gene Name | CD70 CD70 molecule [ Homo sapiens (human) ] |
Official Symbol | CD70 |
Synonyms | CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A |
Gene ID | 970 |
mRNA Refseq | NM_001252.5 |
Protein Refseq | NP_001243.1 |
MIM | 602840 |
UniProt ID | P32970 |
◆ Cell & Tissue Lysates | ||
CD70-1303RCL | Recombinant Rat CD70 cell lysate | +Inquiry |
CD70-2710HCL | Recombinant Human CD70 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD70 Products
Required fields are marked with *
My Review for All CD70 Products
Required fields are marked with *
0
Inquiry Basket