Active Recombinant Full Length Human CD9 Protein, C-Flag-tagged
Cat.No. : | CD9-79HFL |
Product Overview : | Recombinant Full Length Human CD9 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | ELISA positive control |
Molecular Mass : | 25.2 kDa |
AA Sequence : | MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALM MLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQR ETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFG MIFSTILCCAIRRNREMVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways : | Hematopoietic cell lineage |
Full Length : | Full L. |
Gene Name | CD9 CD9 molecule [ Homo sapiens (human) ] |
Official Symbol | CD9 |
Synonyms | MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29 |
Gene ID | 928 |
mRNA Refseq | NM_001769.4 |
Protein Refseq | NP_001760.1 |
MIM | 143030 |
UniProt ID | P21926 |
◆ Native Proteins | ||
LLC-231H | Native Human Lambda Light Chain | +Inquiry |
alpha Thrombin native protein-3287H | Native Human alpha Thrombin | +Inquiry |
CTSG-1649H | Active Native Human CTSG protein | +Inquiry |
NTF3-29249TH | Native Human NTF3 | +Inquiry |
MMP1-45H | Native Human MMP-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MZT1-8296HCL | Recombinant Human C13orf37 293 Cell Lysate | +Inquiry |
ARSB-8677HCL | Recombinant Human ARSB 293 Cell Lysate | +Inquiry |
LAT2-4815HCL | Recombinant Human LAT2 293 Cell Lysate | +Inquiry |
EIF4ENIF1-544HCL | Recombinant Human EIF4ENIF1 cell lysate | +Inquiry |
DUOXA1-1197HCL | Recombinant Human DUOXA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD9 Products
Required fields are marked with *
My Review for All CD9 Products
Required fields are marked with *
0
Inquiry Basket