Active Recombinant Full Length Human CD9 Protein, C-Flag-tagged

Cat.No. : CD9-79HFL
Product Overview : Recombinant Full Length Human CD9 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity : ELISA positive control
Molecular Mass : 25.2 kDa
AA Sequence : MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALM MLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQR ETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFG
MIFSTILCCAIRRNREMVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways : Hematopoietic cell lineage
Full Length : Full L.
Gene Name CD9 CD9 molecule [ Homo sapiens (human) ]
Official Symbol CD9
Synonyms MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29
Gene ID 928
mRNA Refseq NM_001769.4
Protein Refseq NP_001760.1
MIM 143030
UniProt ID P21926

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD9 Products

Required fields are marked with *

My Review for All CD9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon