Recombinant Human CD9 Protein, His-tagged
Cat.No. : | CD9-174H |
Product Overview : | Recombinant human CD9 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 228 |
Description : | This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. |
Form : | Lyophilized |
Molecular Mass : | 10.7 kDa |
AA Sequence : | MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5) |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CD9 CD9 molecule [ Homo sapiens (human) ] |
Official Symbol | CD9 |
Synonyms | CD9; CD9 molecule; CD9 antigen (p24) , MIC3; CD9 antigen; BA2; motility related protein 1; MRP 1; P24; TSPAN29; 5H9 antigen; tetraspanin-29; BA-2/p24 antigen; CD9 antigen (p24); leukocyte antigen MIC3; motility related protein-1; cell growth-inhibiting gene 2 protein; MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN-29; FLJ99568; |
Gene ID | 928 |
mRNA Refseq | NM_001769 |
Protein Refseq | NP_001760 |
MIM | 143030 |
UniProt ID | P21926 |
◆ Recombinant Proteins | ||
CD9-753R | Recombinant Rhesus monkey CD9 Protein, His-tagged | +Inquiry |
CD9-02H | Active Recombinant Human CD9 Protein, Fc-tagged | +Inquiry |
CD9-3116M | Recombinant Mouse CD9 Protein | +Inquiry |
CD9-6464H | Recombinant Human CD9 protein, His&Myc-tagged | +Inquiry |
RFL13136CF | Recombinant Full Length Chlorocebus Aethiops Cd9 Antigen(Cd9) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD9-2110HCL | Recombinant Human CD9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD9 Products
Required fields are marked with *
My Review for All CD9 Products
Required fields are marked with *
0
Inquiry Basket