Recombinant Human CD9 Protein, His-tagged

Cat.No. : CD9-174H
Product Overview : Recombinant human CD9 protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 228
Description : This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis.
Form : Lyophilized
Molecular Mass : 10.7 kDa
AA Sequence : MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5)
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name CD9 CD9 molecule [ Homo sapiens (human) ]
Official Symbol CD9
Synonyms CD9; CD9 molecule; CD9 antigen (p24) , MIC3; CD9 antigen; BA2; motility related protein 1; MRP 1; P24; TSPAN29; 5H9 antigen; tetraspanin-29; BA-2/p24 antigen; CD9 antigen (p24); leukocyte antigen MIC3; motility related protein-1; cell growth-inhibiting gene 2 protein; MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN-29; FLJ99568;
Gene ID 928
mRNA Refseq NM_001769
Protein Refseq NP_001760
MIM 143030
UniProt ID P21926

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD9 Products

Required fields are marked with *

My Review for All CD9 Products

Required fields are marked with *

0
cart-icon