Active Recombinant Full Length Human CLIC2 Protein, C-Flag-tagged

Cat.No. : CLIC2-403HFL
Product Overview : Recombinant Full Length Human CLIC2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a chloride intracellular channel protein. Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. This protein plays a role in inhibiting the function of ryanodine receptor 2. A mutation in this gene is the cause of an X-linked form of cognitive disability.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity : ELISA capture for autoantibodies
Molecular Mass : 28.2 kDa
AA Sequence : MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNP PFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLL KEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFS
GVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Ion Channels: Other
Full Length : Full L.
Gene Name CLIC2 chloride intracellular channel 2 [ Homo sapiens (human) ]
Official Symbol CLIC2
Synonyms CLCNL2; CLIC2b; MRXS32; XAP121
Gene ID 1193
mRNA Refseq NM_001289.6
Protein Refseq NP_001280.3
MIM 300138
UniProt ID O15247

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLIC2 Products

Required fields are marked with *

My Review for All CLIC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon