Active Recombinant Full Length Human CYTL1 Protein, C-Flag-tagged
Cat.No. : | CYTL1-182HFL |
Product Overview : | Recombinant Full Length Human CYTL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | C17 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 surface marker. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Cell treatment |
Molecular Mass : | 15.4 kDa |
AA Sequence : | MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCV LDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | CYTL1 cytokine like 1 [ Homo sapiens (human) ] |
Official Symbol | CYTL1 |
Synonyms | C17; C4orf4 |
Gene ID | 54360 |
mRNA Refseq | NM_018659.3 |
Protein Refseq | NP_061129.1 |
MIM | 607930 |
UniProt ID | Q9NRR1 |
◆ Recombinant Proteins | ||
CYTL1-0381H | Recombinant Human CYTL1 protein, hFc-tagged | +Inquiry |
Cytl1-2432M | Recombinant Mouse Cytl1 Protein, Myc/DDK-tagged | +Inquiry |
CYTL1-182HFL | Active Recombinant Full Length Human CYTL1 Protein, C-Flag-tagged | +Inquiry |
CYTL1-2307H | Recombinant Human CYTL1 Protein, GST-tagged | +Inquiry |
CYTL1-1171R | Recombinant Rhesus monkey CYTL1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYTL1-7091HCL | Recombinant Human CYTL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYTL1 Products
Required fields are marked with *
My Review for All CYTL1 Products
Required fields are marked with *