Active Recombinant Full Length Human DDX5 Protein, C-Flag-tagged
Cat.No. : | DDX5-49HFL |
Product Overview : | Recombinant Full Length Human DDX5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the DEAD box family of RNA helicases that are involved in a variety of cellular processes as a result of its role as an adaptor molecule, promoting interactions with a large number of other factors. This protein is involved in pathways that include the alteration of RNA structures, plays a role as a coregulator of transcription, a regulator of splicing, and in the processing of small noncoding RNAs. Members of this family contain nine conserved motifs, including the conserved Asp-Glu-Ala-Asp (DEAD) motif, important to ATP binding and hydrolysis as well as RNA binding and unwinding activities. Dysregulation of this gene may play a role in cancer development. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Phosphorylation substrate Binding assay |
Molecular Mass : | 69 kDa |
AA Sequence : | MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTA QEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQT GSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQ IRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSA TWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVET KRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPN SSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMK DDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRT GNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Spliceosome |
Full Length : | Full L. |
Gene Name | DDX5 DEAD-box helicase 5 [ Homo sapiens (human) ] |
Official Symbol | DDX5 |
Synonyms | p68; HLR1; G17P1; HUMP68 |
Gene ID | 1655 |
mRNA Refseq | NM_004396.5 |
Protein Refseq | NP_004387.1 |
MIM | 180630 |
UniProt ID | P17844 |
◆ Recombinant Proteins | ||
Ddx5-2510M | Recombinant Mouse Ddx5 Protein, Myc/DDK-tagged | +Inquiry |
DDX5-49HFL | Active Recombinant Full Length Human DDX5 Protein, C-Flag-tagged | +Inquiry |
DDX5-4592H | Recombinant Human DDX5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DDX5-745H | Recombinant Human DDX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDX5-11891Z | Recombinant Zebrafish DDX5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX5-7004HCL | Recombinant Human DDX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDX5 Products
Required fields are marked with *
My Review for All DDX5 Products
Required fields are marked with *
0
Inquiry Basket