Active Recombinant Full Length Human EEF1A1 Protein, C-Flag-tagged
Cat.No. : | EEF1A1-43HFL |
Product Overview : | Recombinant Full Length Human EEF1A1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | ELISA capture for autoantibodies Biolayer interferometry (BLI) assay Binding assay |
Molecular Mass : | 50 kDa |
AA Sequence : | MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERG ITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA YTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPW FKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF APVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP GQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | EEF1A1 eukaryotic translation elongation factor 1 alpha 1 [ Homo sapiens (human) ] |
Official Symbol | EEF1A1 |
Synonyms | CCS3; EF1A; PTI1; CCS-3; EE1A1; EEF-1; EEF1A; EF-Tu; EF1A1; LENG7; eEF1A-1; GRAF-1EF; EF1alpha1 |
Gene ID | 1915 |
mRNA Refseq | NM_001402.6 |
Protein Refseq | NP_001393.1 |
MIM | 130590 |
UniProt ID | P68104 |
◆ Recombinant Proteins | ||
EEF1A1-43HFL | Active Recombinant Full Length Human EEF1A1 Protein, C-Flag-tagged | +Inquiry |
EEF1A1-1670R | Recombinant Rat EEF1A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EEF1A1-803H | Recombinant Human EEF1A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EEF1A1-203H | Recombinant Human EEF1A1 | +Inquiry |
EEF1A1-4205HF | Recombinant Full Length Human EEF1A1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EEF1A1-6717HCL | Recombinant Human EEF1A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EEF1A1 Products
Required fields are marked with *
My Review for All EEF1A1 Products
Required fields are marked with *
0
Inquiry Basket