Active Recombinant Full Length Human FYN Protein, C-Flag-tagged
Cat.No. : | FYN-822HFL |
Product Overview : | Recombinant Full Length Human FYN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | FYN activity verified in a biochemical assay: FYN (FYN oncogene related to SRC, FGR, YES) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. FYN is a non-receptor tyrosine kinase and is a member of the Src kinase family consisting of Src, Fyn, Yes, Lck, Lyn, Hck, Fgr and Blk. Varying concentrations of FYN were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “&DeltaR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors. |
Molecular Mass : | 60.6 kDa |
AA Sequence : | MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSS SHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAP VDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDN GGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNG QFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSL LDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQD CPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Adherens junction, Axon guidance, Fc epsilon RI signaling pathway, Focal adhesion, Natural killer cell mediated cytotoxicity, Pathogenic Escherichia coli infection, Prion diseases, T cell receptor signaling pathway, Viral myocarditis |
Full Length : | Full L. |
Gene Name | FYN FYN proto-oncogene, Src family tyrosine kinase [ Homo sapiens (human) ] |
Official Symbol | FYN |
Synonyms | SLK; SYN; p59-FYN |
Gene ID | 2534 |
mRNA Refseq | NM_002037.5 |
Protein Refseq | NP_002028.1 |
MIM | 137025 |
UniProt ID | P06241 |
◆ Recombinant Proteins | ||
FYN-8109HF | Active Recombinant Full Length Human FYN Protein, GST-tagged | +Inquiry |
FYN-217H | Recombinant Human FYN Oncogene Related To SRC, FGR, YES | +Inquiry |
FYN-4586H | Recombinant Human FYN Protein, GST-tagged | +Inquiry |
Fyn-3119M | Recombinant Mouse Fyn Protein, Myc/DDK-tagged | +Inquiry |
FYN-5284HF | Recombinant Full Length Human FYN Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FYN-6091HCL | Recombinant Human FYN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FYN Products
Required fields are marked with *
My Review for All FYN Products
Required fields are marked with *
0
Inquiry Basket