Active Recombinant Full Length Human GATA3 Protein, C-Flag-tagged
Cat.No. : | GATA3-1052HFL |
Product Overview : | Recombinant Full Length Human GATA3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | GATA3 Activity Verified in a DNA-binding Assay: DNA binding activity of GATA3 as a function of protein concentration. Sensitivity to competitor oligonucleotide demonstrates specificity of protein-DNA binding. EMSA assay |
Molecular Mass : | 47.7 kDa |
AA Sequence : | MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRA TVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSS LSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGG ASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGT GHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHN INRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTP TPMHPPSSLSFGPHHPSSMVTAMGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Adult stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors |
Full Length : | Full L. |
Gene Name | GATA3 GATA binding protein 3 [ Homo sapiens (human) ] |
Official Symbol | GATA3 |
Synonyms | HDR; HDRS |
Gene ID | 2625 |
mRNA Refseq | NM_002051.3 |
Protein Refseq | NP_002042.1 |
MIM | 131320 |
UniProt ID | P23771 |
◆ Recombinant Proteins | ||
GATA3-3483M | Recombinant Mouse GATA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GATA3-5436HFL | Recombinant Full Length Human GATA3 protein, Flag-tagged | +Inquiry |
GATA3-5467HF | Recombinant Full Length Human GATA3 Protein, GST-tagged | +Inquiry |
GATA3-2939H | Recombinant Human GATA3 protein, GST-tagged | +Inquiry |
GATA3-6224M | Recombinant Mouse GATA3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GATA3-6011HCL | Recombinant Human GATA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GATA3 Products
Required fields are marked with *
My Review for All GATA3 Products
Required fields are marked with *
0
Inquiry Basket