Active Recombinant Full Length Human GATA3 Protein, C-Flag-tagged

• Cat.No.: GATA3-1052HFL
• Product Overview: Recombinant Full Length Human GATA3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: GATA3 Activity Verified in a DNA-binding Assay: DNA binding activity of GATA3 as a function of protein concentration. Sensitivity to competitor oligonucleotide demonstrates specificity of protein-DNA binding.
  EMSA assay
• Molecular Mass: 47.7 kDa
• AA Sequence: MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRA TVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSS LSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGG ASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGT GHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHN INRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTP
  TPMHPPSSLSFGPHHPSSMVTAMGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Adult stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors
• Full Length: Full L.

Gene Information

• Gene Name: GATA3 GATA binding protein 3 [ Homo sapiens (human) ]
• Official Symbol: GATA3
• Synonyms: HDR; HDRS
• Gene ID: 2625
• mRNA Refseq: NM_002051.3
• Protein Refseq: NP_002042.1
• MIM: 131320
• UniProt ID: P23771