Active Recombinant Full Length Human GSK3A Protein, C-Flag-tagged
| Cat.No. : | GSK3A-156HFL |
| Product Overview : | Recombinant Full Length Human GSK3A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, as well as regulates the production of beta-amyloid peptides associated with Alzheimer's disease. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Bio-activity : | In vitro kinase assay (enzyme) Thermophoresis assay |
| Molecular Mass : | 50.8 kDa |
| AA Sequence : | MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPG GSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAE TRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFT KAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYI CSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPN YTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLTNSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Protein Kinase |
| Protein Pathways : | Chemokine signaling pathway |
| Full Length : | Full L. |
| Gene Name | GSK3A glycogen synthase kinase 3 alpha [ Homo sapiens (human) ] |
| Official Symbol | GSK3A |
| Synonyms | DKFZp686D0638 |
| Gene ID | 2931 |
| mRNA Refseq | NM_019884.3 |
| Protein Refseq | NP_063937.2 |
| MIM | 606784 |
| UniProt ID | P49840 |
| ◆ Recombinant Proteins | ||
| Gsk3a-636R | Recombinant Rat Gsk3a protein, His & T7-tagged | +Inquiry |
| GSK3A-156HFL | Active Recombinant Full Length Human GSK3A Protein, C-Flag-tagged | +Inquiry |
| GSK3A-3328HF | Recombinant Full Length Human GSK3A Protein, GST-tagged | +Inquiry |
| GSK3A-1411H | Active Recombinant Human GSK3 alpha, GST-tagged | +Inquiry |
| Gsk3a-3317M | Recombinant Mouse Gsk3a Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSK3A-188HKCL | Human GSK3A Knockdown Cell Lysate | +Inquiry |
| GSK3A-5723HCL | Recombinant Human GSK3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSK3A Products
Required fields are marked with *
My Review for All GSK3A Products
Required fields are marked with *
