Active Recombinant Full Length Human NCF1 Protein, C-Flag-tagged
Cat.No. : | NCF1-576HFL |
Product Overview : | Recombinant Full Length Human NCF1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a 47 kDa cytosolic subunit of neutrophil NADPH oxidase. This oxidase is a multicomponent enzyme that is activated to produce superoxide anion. Mutations in this gene have been associated with chronic granulomatous disease. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme substrate |
Molecular Mass : | 44.5 kDa |
AA Sequence : | MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENR IIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYL MPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFL EPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYL QKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPL EEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASPVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Chemokine signaling pathway, Fc gamma R-mediated phagocytosis, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | NCF1 neutrophil cytosolic factor 1 [ Homo sapiens (human) ] |
Official Symbol | NCF1 |
Synonyms | CGD1; NCF1A; NOXO2; p47phox; SH3PXD1A |
Gene ID | 653361 |
mRNA Refseq | NM_000265.7 |
Protein Refseq | NP_000256.4 |
MIM | 608512 |
UniProt ID | P14598 |
◆ Recombinant Proteins | ||
NCF1-5937M | Recombinant Mouse NCF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NCF1-2411C | Recombinant Chicken NCF1 | +Inquiry |
NCF1-1208H | Recombinant Human NCF1, His-tagged | +Inquiry |
NCF1-1485H | Recombinant Human NCF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NCF1-2749H | Recombinant Human Neutrophil Cytosolic Factor 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCF1-3950HCL | Recombinant Human NCF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCF1 Products
Required fields are marked with *
My Review for All NCF1 Products
Required fields are marked with *
0
Inquiry Basket