Active Recombinant Full Length Human PIP Protein, C-Flag-tagged
Cat.No. : | PIP-120HFL |
Product Overview : | Recombinant Full Length Human PIP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables IgG binding activity; aspartic-type endopeptidase activity; and identical protein binding activity. Involved in several processes, including detection of chemical stimulus involved in sensory perception of bitter taste; negative regulation of T cell apoptotic process; and proteolysis. Located in extracellular space and nucleus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Cell treatment |
Molecular Mass : | 16.4 kDa |
AA Sequence : | MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKT YLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTI EILKVETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | PIP prolactin induced protein [ Homo sapiens (human) ] |
Official Symbol | PIP |
Synonyms | GPIP4; BRST-2; GCDFP15; GCDFP-15 |
Gene ID | 5304 |
mRNA Refseq | NM_002652.3 |
Protein Refseq | NP_002643.1 |
MIM | 176720 |
UniProt ID | P12273 |
◆ Recombinant Proteins | ||
PIP-4911H | Recombinant Human PIP Protein (Met1-Glu146), His tagged | +Inquiry |
PIP-132H | Recombinant Human Prolactin-induced Protein | +Inquiry |
Pip-1926R | Recombinant Rat Pip protein, His & GST-tagged | +Inquiry |
Pip-1925M | Recombinant Mouse Pip protein, His & GST-tagged | +Inquiry |
PIP-1683H | Recombinant Human PIP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PIP-20H | Native Human PIP Protein (118 aa) | +Inquiry |
PIP-17HFL | Native Full Length Human Prolactin inducible protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIP-3176HCL | Recombinant Human PIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIP Products
Required fields are marked with *
My Review for All PIP Products
Required fields are marked with *