Active Recombinant Full Length Human PIP Protein, C-Flag-tagged
| Cat.No. : | PIP-120HFL |
| Product Overview : | Recombinant Full Length Human PIP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables IgG binding activity; aspartic-type endopeptidase activity; and identical protein binding activity. Involved in several processes, including detection of chemical stimulus involved in sensory perception of bitter taste; negative regulation of T cell apoptotic process; and proteolysis. Located in extracellular space and nucleus. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Bio-activity : | Cell treatment |
| Molecular Mass : | 16.4 kDa |
| AA Sequence : | MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKT YLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTI EILKVETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Secreted Protein |
| Full Length : | Full L. |
| Gene Name | PIP prolactin induced protein [ Homo sapiens (human) ] |
| Official Symbol | PIP |
| Synonyms | GPIP4; BRST-2; GCDFP15; GCDFP-15 |
| Gene ID | 5304 |
| mRNA Refseq | NM_002652.3 |
| Protein Refseq | NP_002643.1 |
| MIM | 176720 |
| UniProt ID | P12273 |
| ◆ Recombinant Proteins | ||
| PIP-1683H | Recombinant Human PIP Protein, His (Fc)-Avi-tagged | +Inquiry |
| PIP-5495H | Recombinant Human PIP protein, His-tagged | +Inquiry |
| pip-3724M | Recombinant Mycoplasma pneumoniae pip protein, His-SUMO-tagged | +Inquiry |
| Pip-5747R | Recombinant Rat Pip protein, His-tagged | +Inquiry |
| PIP-4468R | Recombinant Rat PIP Protein | +Inquiry |
| ◆ Native Proteins | ||
| PIP-17HFL | Native Full Length Human Prolactin inducible protein | +Inquiry |
| PIP-20H | Native Human PIP Protein (118 aa) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PIP-3176HCL | Recombinant Human PIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIP Products
Required fields are marked with *
My Review for All PIP Products
Required fields are marked with *
