Active Recombinant Full Length Human SYT1 Protein, C-Flag-tagged
| Cat.No. : | SYT1-426HFL |
| Product Overview : | Recombinant Full Length Human SYT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the synapse. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Bio-activity : | MS digestion standard |
| Molecular Mass : | 47.4 kDa |
| AA Sequence : | MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVL LVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEE EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQ FTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFS LRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPF EQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV KKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Secreted Protein, Transmembrane |
| Full Length : | Full L. |
| Gene Name | SYT1 synaptotagmin 1 [ Homo sapiens (human) ] |
| Official Symbol | SYT1 |
| Synonyms | P65; SYT; BAGOS; SVP65 |
| Gene ID | 6857 |
| mRNA Refseq | NM_001135806.2 |
| Protein Refseq | NP_001129278.1 |
| MIM | 185605 |
| UniProt ID | P21579 |
| ◆ Recombinant Proteins | ||
| SYT1-996C | Recombinant Cynomolgus SYT1 Protein, His-tagged | +Inquiry |
| SYT1-083H | Recombinant Human SYT1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SYT1-31492TH | Recombinant Human SYT1 | +Inquiry |
| RFL22382HF | Recombinant Full Length Human Synaptotagmin-1(Syt1) Protein, His-Tagged | +Inquiry |
| SYT1-6479H | Recombinant Human SYT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYT1 Products
Required fields are marked with *
My Review for All SYT1 Products
Required fields are marked with *
