Active Recombinant Full Length Human TAGLN2 Protein, C-Flag-tagged
Cat.No. : | TAGLN2-315HFL |
Product Overview : | Recombinant Full Length Human TAGLN2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is similar to the protein transgelin, which is one of the earliest markers of differentiated smooth muscle. The specific function of this protein has not yet been determined, although it is thought to be a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | ELISA standard |
Molecular Mass : | 22.2 kDa |
AA Sequence : | MANRGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINALY PEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLMNLGGLAVARD DGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPRQILTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | TAGLN2 transgelin 2 [ Homo sapiens (human) ] |
Official Symbol | TAGLN2 |
Synonyms | HA1756 |
Gene ID | 8407 |
mRNA Refseq | NM_003564.3 |
Protein Refseq | NP_003555.1 |
MIM | 604634 |
UniProt ID | P37802 |
◆ Recombinant Proteins | ||
TAGLN2-4428R | Recombinant Rhesus Macaque TAGLN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAGLN2-5920R | Recombinant Rat TAGLN2 Protein | +Inquiry |
TAGLN2-3550H | Recombinant Human TAGLN2 protein, His-SUMO-tagged | +Inquiry |
TAGLN2-5579R | Recombinant Rat TAGLN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAGLN2-315HFL | Active Recombinant Full Length Human TAGLN2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAGLN2-1261HCL | Recombinant Human TAGLN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAGLN2 Products
Required fields are marked with *
My Review for All TAGLN2 Products
Required fields are marked with *