Active Recombinant Full Length Human UBE2L3 Protein, C-Flag-tagged
Cat.No. : | UBE2L3-323HFL |
Product Overview : | Recombinant Full Length Human UBE2L3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro. Several alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | ELISA capture for autoantibodies |
Molecular Mass : | 17.7 kDa |
AA Sequence : | MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITF KTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNA EEFTKKYGEKRPVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Parkinson's disease, Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | UBE2L3 ubiquitin conjugating enzyme E2 L3 [ Homo sapiens (human) ] |
Official Symbol | UBE2L3 |
Synonyms | E2-F1; L-UBC; UBCH7; UbcM4 |
Gene ID | 7332 |
mRNA Refseq | NM_003347.4 |
Protein Refseq | NP_003338.1 |
MIM | 603721 |
UniProt ID | P68036 |
◆ Recombinant Proteins | ||
UBE2L3-2544H | Recombinant Human UBE2L3 protein, His-tagged | +Inquiry |
UBE2L3-33H | Recombinant Full Length Human Ubiquitin-conjugating Enzyme E2L 3/UBE2L3 Protein | +Inquiry |
UBE2L3-31661TH | Recombinant Human UBE2L3 | +Inquiry |
UBE2L3-1333S | Recombinant Human UBE2L3 Protein (A2-D154), Tag Free | +Inquiry |
UBE2L3-9832M | Recombinant Mouse UBE2L3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2L3-570HCL | Recombinant Human UBE2L3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2L3 Products
Required fields are marked with *
My Review for All UBE2L3 Products
Required fields are marked with *
0
Inquiry Basket