Recombinant Human UBE2L3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : UBE2L3-4247H
Product Overview : UBE2L3 MS Standard C13 and N15-labeled recombinant protein (NP_003338) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro. Several alternatively spliced transcript variants have been found for this gene.
Molecular Mass : 17.9 kDa
AA Sequence : MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name UBE2L3 ubiquitin-conjugating enzyme E2L 3 [ Homo sapiens (human) ]
Official Symbol UBE2L3
Synonyms UBE2L3; ubiquitin-conjugating enzyme E2L 3; ubiquitin-conjugating enzyme E2 L3; UBCH7; ubiquitin-protein ligase L3; ubiquitin carrier protein L3; ubiquitin-conjugating enzyme E2-F1; ubiquitin-conjugating enzyme UBCH7; E2-F1; L-UBC; UbcM4;
Gene ID 7332
mRNA Refseq NM_003347
Protein Refseq NP_003338
MIM 603721
UniProt ID P68036

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE2L3 Products

Required fields are marked with *

My Review for All UBE2L3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon