Recombinant Human UBE2L3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | UBE2L3-4247H |
Product Overview : | UBE2L3 MS Standard C13 and N15-labeled recombinant protein (NP_003338) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro. Several alternatively spliced transcript variants have been found for this gene. |
Molecular Mass : | 17.9 kDa |
AA Sequence : | MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | UBE2L3 ubiquitin-conjugating enzyme E2L 3 [ Homo sapiens (human) ] |
Official Symbol | UBE2L3 |
Synonyms | UBE2L3; ubiquitin-conjugating enzyme E2L 3; ubiquitin-conjugating enzyme E2 L3; UBCH7; ubiquitin-protein ligase L3; ubiquitin carrier protein L3; ubiquitin-conjugating enzyme E2-F1; ubiquitin-conjugating enzyme UBCH7; E2-F1; L-UBC; UbcM4; |
Gene ID | 7332 |
mRNA Refseq | NM_003347 |
Protein Refseq | NP_003338 |
MIM | 603721 |
UniProt ID | P68036 |
◆ Recombinant Proteins | ||
UBE2L3-31661TH | Recombinant Human UBE2L3 | +Inquiry |
Ube2l3-6792M | Recombinant Mouse Ube2l3 Protein, Myc/DDK-tagged | +Inquiry |
UBE2L3-17723M | Recombinant Mouse UBE2L3 Protein | +Inquiry |
UBE2L3-1499H | Recombinant Human Ubiquitin-Conjugating Enzyme E2L 3, His-tagged | +Inquiry |
UBE2L3-6533H | Recombinant Human UBE2L3 Protein (Ser4-Asp154), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2L3-570HCL | Recombinant Human UBE2L3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2L3 Products
Required fields are marked with *
My Review for All UBE2L3 Products
Required fields are marked with *