Active Recombinant Full Length Human YWHAE Protein, C-Flag-tagged
Cat.No. : | YWHAE-237HFL |
Product Overview : | Recombinant Full Length Human YWHAE Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Two transcript variants, one protein-coding and the other non-protein-coding, have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | In vitro ubiquitination assay (regulator) Co-immunoprecipitation |
Molecular Mass : | 29 kDa |
AA Sequence : | MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE ENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGND RKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis |
Full Length : | Full L. |
Gene Name | YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [ Homo sapiens (human) ] |
Official Symbol | YWHAE |
Synonyms | MDS; HEL2; MDCR; KCIP-1; 14-3-3E |
Gene ID | 7531 |
mRNA Refseq | NM_006761.5 |
Protein Refseq | NP_006752.1 |
MIM | 605066 |
UniProt ID | P62258 |
◆ Recombinant Proteins | ||
YWHAE-6638R | Recombinant Rat YWHAE Protein | +Inquiry |
YWHAE-1367C | Recombinant Chicken YWHAE | +Inquiry |
YWHAE-137H | Recombinant Human YWHAE Protein, His-tagged | +Inquiry |
YWHAE-18683M | Recombinant Mouse YWHAE Protein | +Inquiry |
YWHAE-26003TH | Recombinant Human YWHAE | +Inquiry |
◆ Cell & Tissue Lysates | ||
YWHAE-740HCL | Recombinant Human YWHAE lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YWHAE Products
Required fields are marked with *
My Review for All YWHAE Products
Required fields are marked with *
0
Inquiry Basket