Active Recombinant Full Length Mouse carboxyl ester lipase Protein, His Tagged
| Cat.No. : | Cel-01MFL | 
| Product Overview : | Recombinant mouse CEL (Full length, 1-599aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse | 
| Source : | Baculovirus | 
| Tag : | His | 
| Protein Length : | 1-599aa | 
| Description : | Predicted to enable several functions, including carboxylic ester hydrolase activity; glycosphingolipid binding activity; and neurexin family protein binding activity. Acts upstream of or within ceramide catabolic process. Predicted to be located in several cellular components, including membrane raft; rough endoplasmic reticulum; and zymogen granule. Predicted to be part of protein-containing complex. Predicted to be active in cell surface and synapse. Predicted to be integral component of postsynaptic specialization membrane. Is expressed in several structures, including gut and mammary gland. Human ortholog(s) of this gene implicated in lipomatosis; maturity-onset diabetes of the young type 8; type 1 diabetes mellitus; and type 2 diabetes mellitus. Orthologous to human CEL (carboxyl ester lipase). | 
| Tag : | C-His | 
| Form : | Liquid | 
| Bio-activity : | > 100,000 pmol/min/μg, and is defined as the amount of enzyme that hydrolyze 1.0 μmole of p-nitrophenyl butyrate to p-nitrophenol per minute at pH 7.5 at 25 centigrade. | 
| Molecular Mass : | 64.5 kDa | 
| AA Sequence : | AKLGAVYTEGGFVEGVNKKLSLLGGDSVDIFKGIPFATAKTLENPQRHPGWQGTLKATNFKKRCLQATITQDNTYGQEDCLYLNIWVPQGRKQVSHNLPVMVWIYGGAFLMGSGQGANFLKNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNFGLRDQHMAIAWVKRNIAAFGGDPDNITIFGESAGAASVSLQTLSPYNKGLIRRAISQSGMALSPWAIQKNPLFWAKTIAKKVGCPTEDTGKMAACLKITDPRALTLAYKLPVKKQEYPVVHYLAFIPVIDGDFIPDDPINLYNNTADIDYIAGINNMDGHLFATIDVPAVDKTKQTVTEEDFYRLVSGHTVAKGLKGAQATFDIYTESWAQDPSQENMKKTVVAFETDVLFLIPTEIALAQHKAHAKSAKTYSYLFSHPSRMPIYPKWMGADHADDLQYVFGKPFATPLGYRPQDRAVSKAMIAYWTNFARSGDPNMGNSPVPTHWYPYTLENGNYLDITKTITSASMKEHLREKFLKFWAVTFEVLPTVTGDQDTLTPPEDDSEVAPDPPSDDSQVVPVPPTDDSVEAQMPATIGF | 
| Endotoxin : | < 1 EU/μg of protein (determined by LAL method) | 
| Purity : | > 90% by SDS-PAGE | 
| Applications : | SDS-PAGE, Enzyme Activity | 
| Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. | 
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. | 
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol | 
| Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) | 
| References : | 1. Xiao X., et al. (2016) J Biol Chem. 291:23224-23236. 2. Shindo K., et al. (2017) Oncotarget. 8:50824-50831. | 
| Gene Name | Cel carboxyl ester lipase [ Mus musculus (house mouse) ] | 
| Official Symbol | Cel | 
| Synonyms | Cel; carboxyl ester lipase; BAL; BSSL; 1810036E18Rik; bile salt-activated lipase; bile salt-stimulated lipase; cholesterol esterase; pancreatic lysophospholipase; sterol esterase; EC 3.1.1.13; EC 3.1.1.3; EC 3.1.1.6 | 
| Gene ID | 12613 | 
| mRNA Refseq | NM_009885 | 
| Protein Refseq | NP_034015 | 
| UniProt ID | Q64285 | 
| ◆ Recombinant Proteins | ||
| Cel-01MFL | Active Recombinant Full Length Mouse carboxyl ester lipase Protein, His Tagged | +Inquiry | 
| CEL-2168C | Recombinant Chicken CEL | +Inquiry | 
| Cel-488M | Recombinant Mouse Cel protein, His-tagged | +Inquiry | 
| CEL-1109H | Recombinant Human CEL Protein, GST-Tagged | +Inquiry | 
| CEL-569H | Recombinant Human CEL Protein, His/GST-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cel Products
Required fields are marked with *
My Review for All Cel Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            