Active Recombinant Human ACVR1B, Fc-tagged, Biotinylated
| Cat.No. : | ACVR1B-528H |
| Product Overview : | The recombinant human ACVR1B-Fc fusion protein is expressed as a 331 amino acid protein consisting of Ser24 - Glu126 region of ACVR1B (UniProt accession #P36896) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 24-126 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Immobilized ACVR1B binds human Cripto in a functional ELISA. Blocks Cripto-mediated signaling activity. |
| Molecular Mass : | Calculated molecular mass (kDa): 37.0; Estimated by SDS-PAGE under reducing condition (kDa): ~45 |
| AA Sequence : | SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCY TDYCNRIDLRVPSGHLKEPEHPSMWGPVESTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | ACVR1B activin A receptor, type IB [ Homo sapiens ] |
| Official Symbol | ACVR1B |
| Synonyms | ACVR1B; activin A receptor, type IB; ACVRLK4; activin receptor type-1B; ActRIB; ALK4; SKR2; activin receptor-like kinase 4; activin A receptor, type II-like kinase 4; serine/threonine-protein kinase receptor R2; ACTRIB; |
| Gene ID | 91 |
| mRNA Refseq | NM_004302 |
| Protein Refseq | NP_004293 |
| MIM | 601300 |
| UniProt ID | P36896 |
| Chromosome Location | 12q13 |
| Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Developmental Biology, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; |
| Function | ATP binding; SMAD binding; contributes_to activin binding; activin receptor activity, type I; activin receptor activity, type I; contributes_to activin-activated receptor activity; contributes_to growth factor binding; inhibin binding; metal ion binding; nucleotide binding; protein binding; protein serine/threonine kinase activity; protein serine/threonine kinase activity; receptor activity; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity; ubiquitin protein ligase binding; |
| ◆ Recombinant Proteins | ||
| ACVR1B-231H | Recombinant Human ACVR1B protein, GST/His-tagged | +Inquiry |
| ACVR1B-2614H | Active Recombinant Human ACVR1B protein, hFc&His-tagged | +Inquiry |
| ACVR1B-1289H | Recombinant Human ACVR1B Protein (N150-I505), His tagged | +Inquiry |
| ACVR1B-332H | Recombinant Human Activin ACVR1B protein, Fc-tagged | +Inquiry |
| ACVR1B-59R | Recombinant Rhesus Macaque ACVR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACVR1B-1206RCL | Recombinant Rat ACVR1B cell lysate | +Inquiry |
| ACVR1B-1356CCL | Recombinant Cynomolgus ACVR1B cell lysate | +Inquiry |
| ACVR1B-2130HCL | Recombinant Human ACVR1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACVR1B Products
Required fields are marked with *
My Review for All ACVR1B Products
Required fields are marked with *
