Active Recombinant Human ACVR1B, Fc-tagged, Biotinylated

Cat.No. : ACVR1B-528H
Product Overview : The recombinant human ACVR1B-Fc fusion protein is expressed as a 331 amino acid protein consisting of Ser24 - Glu126 region of ACVR1B (UniProt accession #P36896) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 24-126 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized ACVR1B binds human Cripto in a functional ELISA. Blocks Cripto-mediated signaling activity.
Molecular Mass : Calculated molecular mass (kDa): 37.0; Estimated by SDS-PAGE under reducing condition (kDa): ~45
AA Sequence : SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCY TDYCNRIDLRVPSGHLKEPEHPSMWGPVESTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name ACVR1B activin A receptor, type IB [ Homo sapiens ]
Official Symbol ACVR1B
Synonyms ACVR1B; activin A receptor, type IB; ACVRLK4; activin receptor type-1B; ActRIB; ALK4; SKR2; activin receptor-like kinase 4; activin A receptor, type II-like kinase 4; serine/threonine-protein kinase receptor R2; ACTRIB;
Gene ID 91
mRNA Refseq NM_004302
Protein Refseq NP_004293
MIM 601300
UniProt ID P36896
Chromosome Location 12q13
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Developmental Biology, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem;
Function ATP binding; SMAD binding; contributes_to activin binding; activin receptor activity, type I; activin receptor activity, type I; contributes_to activin-activated receptor activity; contributes_to growth factor binding; inhibin binding; metal ion binding; nucleotide binding; protein binding; protein serine/threonine kinase activity; protein serine/threonine kinase activity; receptor activity; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity; ubiquitin protein ligase binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACVR1B Products

Required fields are marked with *

My Review for All ACVR1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon