Active Recombinant Human ADIPOQ Protein
| Cat.No. : | ADIPOQ-300A |
| Product Overview : | Recombinant Human ADIPOQ Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | CHO |
| Description : | Adiponectin is an important adipokine involved in the control of fat metabolism and insulin sensitivity. It is synthesized exclusively by adipocytes and secreted into plasma. It antagonizes THF-alpha by negatively regulating its expression. It also inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. Adiponectin can form low molecular weight complexes (LMW), middle molecular weight complexes (MMW) and higher molecular weight complexes (HMW). These bind to various growth factors, such as HBEGF, PDGFB and FGF2, and play a role in cell growth, angiogenesis and tissue remodeling. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 2 ng/mL, measured in a cell growth inhibition assay using M1 cells. |
| Molecular Mass : | 25~28 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
| Storage : | Lyophilized recombinant Human Adiponectin remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Adiponectinshould be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
| Gene Name | ADIPOQ adiponectin, C1Q and collagen domain containing [ Homo sapiens ] |
| Official Symbol | ADIPOQ |
| Synonyms | ADIPOQ; adiponectin, C1Q and collagen domain containing; ACDC, adipocyte, C1Q and collagen domain containing; adiponectin; ACRP30; AdipoQ; adipose most abundant gene transcript 1; apM1; GBP28; gelatin-binding protein 28; adipose specific collagen-like factor; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipose most abundant gene transcript 1 protein; ACDC; ADPN; APM1; APM-1; ADIPQTL1; |
| Gene ID | 9370 |
| mRNA Refseq | NM_001177800 |
| Protein Refseq | NP_001171271 |
| MIM | 605441 |
| UniProt ID | Q15848 |
| ◆ Recombinant Proteins | ||
| ADIPOQ-44H | Recombinant Human ADIPOQ, His-tagged | +Inquiry |
| Adipoq-7149M | Recombinant Mouse Adipoq Protein | +Inquiry |
| Adipoq-033M | Active Recombinant Mouse Adipoq Protein, His-tagged | +Inquiry |
| ADIPOQ-0395H | Recombinant Human ADIPOQ Protein, Tag Free | +Inquiry |
| Adipoq-79M | Active Recombinant Mouse Adipoq, FLAG-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADIPOQ-1526HCL | Recombinant Human ADIPOQ cell lysate | +Inquiry |
| ADIPOQ-2209MCL | Recombinant Mouse ADIPOQ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADIPOQ Products
Required fields are marked with *
My Review for All ADIPOQ Products
Required fields are marked with *
