Active Recombinant Human ADIPOQ Protein

Cat.No. : ADIPOQ-300A
Product Overview : Recombinant Human ADIPOQ Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Description : Adiponectin is an important adipokine involved in the control of fat metabolism and insulin sensitivity. It is synthesized exclusively by adipocytes and secreted into plasma. It antagonizes THF-alpha by negatively regulating its expression. It also inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. Adiponectin can form low molecular weight complexes (LMW), middle molecular weight complexes (MMW) and higher molecular weight complexes (HMW). These bind to various growth factors, such as HBEGF, PDGFB and FGF2, and play a role in cell growth, angiogenesis and tissue remodeling.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 2 ng/mL, measured in a cell growth inhibition assay using M1 cells.
Molecular Mass : 25~28 kDa, observed by reducing SDS-PAGE.
AA Sequence : ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Human Adiponectin remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Adiponectinshould be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name ADIPOQ adiponectin, C1Q and collagen domain containing [ Homo sapiens ]
Official Symbol ADIPOQ
Synonyms ADIPOQ; adiponectin, C1Q and collagen domain containing; ACDC, adipocyte, C1Q and collagen domain containing; adiponectin; ACRP30; AdipoQ; adipose most abundant gene transcript 1; apM1; GBP28; gelatin-binding protein 28; adipose specific collagen-like factor; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipose most abundant gene transcript 1 protein; ACDC; ADPN; APM1; APM-1; ADIPQTL1;
Gene ID 9370
mRNA Refseq NM_001177800
Protein Refseq NP_001171271
MIM 605441
UniProt ID Q15848

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADIPOQ Products

Required fields are marked with *

My Review for All ADIPOQ Products

Required fields are marked with *

0

Inquiry Basket

cartIcon