Active Recombinant Human ANGPT2 protein, His-tagged
| Cat.No. : | ANGPT2-550H |
| Product Overview : | Human ANGPT2 (O15123) partial recombinant protein with His tag expressed in CHO cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Hamster |
| Tag : | His |
| Description : | The protein encoded by this gene is an antagonist of angiopoietin 1 (ANGPT1) and endothelial TEK tyrosine kinase (TIE-2, TEK). The encoded protein disrupts the vascular remodeling ability of ANGPT1 and may induce endothelial cell apoptosis. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Form : | Lyophilized |
| Bio-activity : | Determined by its ability to stimulate tubulogenesis in HUVEC cells using a concentration of 0.2 ug/ml. |
| Molecular Mass : | 60-70 kDa |
| AA Sequence : | DAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADFHHHHHH |
| Endotoxin : | Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug). |
| Purity : | 95% |
| Applications : | Functional Study; SDS-PAGE |
| Usage : | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage : | Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | Lyophilized from solutions contain no sodiun azide nor carrier protein |
| Gene Name | ANGPT2 angiopoietin 2 [ Homo sapiens ] |
| Official Symbol | ANGPT2 |
| Synonyms | ANGPT2; angiopoietin 2; angiopoietin-2; Ang2; ANG-2; Tie2-ligand; angiopoietin-2B; angiopoietin-2a; ANG2; AGPT2; |
| Gene ID | 285 |
| mRNA Refseq | NM_001118887 |
| Protein Refseq | NP_001112359 |
| MIM | 601922 |
| UniProt ID | O15123 |
| ◆ Recombinant Proteins | ||
| ANGPT2-315R | Active Recombinant Rabbit ANGPT2 protein, His-tagged | +Inquiry |
| ANGPT2-2468H | Recombinant Human ANGPT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ANGPT2-524HB | Active Recombinant Human ANGPT2 protein, His & Avi-tagged, Biotinylated | +Inquiry |
| ANGPT2-531H | Active Recombinant Human ANGPT2 protein, His-tagged | +Inquiry |
| ANGPT2-01P | Recombinant Pig ANGPT2 Protein, N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANGPT2-2228HCL | Recombinant Human ANGPT2 cell lysate | +Inquiry |
| ANGPT2-001MCL | Recombinant Mouse ANGPT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPT2 Products
Required fields are marked with *
My Review for All ANGPT2 Products
Required fields are marked with *



