Active Recombinant Human ANGPT2 protein, His-tagged
Cat.No. : | ANGPT2-550H |
Product Overview : | Human ANGPT2 (O15123) partial recombinant protein with His tag expressed in CHO cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Hamster |
Tag : | His |
Description : | The protein encoded by this gene is an antagonist of angiopoietin 1 (ANGPT1) and endothelial TEK tyrosine kinase (TIE-2, TEK). The encoded protein disrupts the vascular remodeling ability of ANGPT1 and may induce endothelial cell apoptosis. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Form : | Lyophilized |
Bio-activity : | Determined by its ability to stimulate tubulogenesis in HUVEC cells using a concentration of 0.2 ug/ml. |
Molecular Mass : | 60-70 kDa |
AA Sequence : | DAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADFHHHHHH |
Endotoxin : | Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug). |
Purity : | 95% |
Applications : | Functional Study; SDS-PAGE |
Usage : | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
Storage : | Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | Lyophilized from solutions contain no sodiun azide nor carrier protein |
Gene Name | ANGPT2 angiopoietin 2 [ Homo sapiens ] |
Official Symbol | ANGPT2 |
Synonyms | ANGPT2; angiopoietin 2; angiopoietin-2; Ang2; ANG-2; Tie2-ligand; angiopoietin-2B; angiopoietin-2a; ANG2; AGPT2; |
Gene ID | 285 |
mRNA Refseq | NM_001118887 |
Protein Refseq | NP_001112359 |
MIM | 601922 |
UniProt ID | O15123 |
◆ Recombinant Proteins | ||
ANGPT2-200H | Active Recombinant Human ANGPT2 protein, hFc-tagged | +Inquiry |
ANGPT2-6380C | Recombinant Chicken ANGPT2 | +Inquiry |
ANGPT2-1067H | Recombinant Human ANGPT2 Protein (Met1-Gln248 and Lys275-Phe496), MlgG2a Fc-tagged | +Inquiry |
ANGPT2-1034HF | Recombinant Full Length Human ANGPT2 Protein, GST-tagged | +Inquiry |
ANGPT2-696H | Recombinant Human ANGPT2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPT2-001MCL | Recombinant Mouse ANGPT2 cell lysate | +Inquiry |
ANGPT2-2228HCL | Recombinant Human ANGPT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPT2 Products
Required fields are marked with *
My Review for All ANGPT2 Products
Required fields are marked with *