Active Recombinant Human beta-NGF Protein

Cat.No. : NGF-213H
Product Overview : Recombinant Human beta-NGF Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Nerve growth factor beta (beta-NGF) is a neurotrophic factor that is important for the development and maintenance of sensory and sympathetic neurons. beta-NGF signals through the low affinity nerve growth factor receptor (LNGFR) and the tropomyosin receptor kinase A (TrkA) to activate PI3K, Ras, and PLC signaling pathways. beta-NGF is also involved in the growth, differentiation, and survival of B lymphocytes. Human, mouse, and rat beta-NGF proteins are cross-reactive.
Bio-activity : TF-1 cell proliferation, ≤5 ng/mL
Molecular Mass : Dimer, 13.6/27.3 kDa (121/242 aa)
AA Sequence : MSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name NGF nerve growth factor (beta polypeptide) [ Homo sapiens (human) ]
Official Symbol NGF
Synonyms NGF; nerve growth factor (beta polypeptide); NGFB; beta-nerve growth factor; nerve growth factor, beta subunit; HSAN5; Beta-NGF; MGC161426; MGC161428;
Gene ID 4803
mRNA Refseq NM_002506
Protein Refseq NP_002497
MIM 162030
UniProt ID P01138

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NGF Products

Required fields are marked with *

My Review for All NGF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon