Active Recombinant Human beta-NGF Protein
Cat.No. : | NGF-213H |
Product Overview : | Recombinant Human beta-NGF Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Nerve growth factor beta (beta-NGF) is a neurotrophic factor that is important for the development and maintenance of sensory and sympathetic neurons. beta-NGF signals through the low affinity nerve growth factor receptor (LNGFR) and the tropomyosin receptor kinase A (TrkA) to activate PI3K, Ras, and PLC signaling pathways. beta-NGF is also involved in the growth, differentiation, and survival of B lymphocytes. Human, mouse, and rat beta-NGF proteins are cross-reactive. |
Bio-activity : | TF-1 cell proliferation, ≤5 ng/mL |
Molecular Mass : | Dimer, 13.6/27.3 kDa (121/242 aa) |
AA Sequence : | MSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | NGF nerve growth factor (beta polypeptide) [ Homo sapiens (human) ] |
Official Symbol | NGF |
Synonyms | NGF; nerve growth factor (beta polypeptide); NGFB; beta-nerve growth factor; nerve growth factor, beta subunit; HSAN5; Beta-NGF; MGC161426; MGC161428; |
Gene ID | 4803 |
mRNA Refseq | NM_002506 |
Protein Refseq | NP_002497 |
MIM | 162030 |
UniProt ID | P01138 |
◆ Native Proteins | ||
Ngf-51M | Native Mouse Nerve Growth Factor 2.5S | +Inquiry |
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGF-001HCL | Recombinant Human NGF cell lysate | +Inquiry |
NGF-001MCL | Recombinant Mouse NGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NGF Products
Required fields are marked with *
My Review for All NGF Products
Required fields are marked with *