Active Recombinant Human BMP2 protein
Cat.No. : | BMP2-011H |
Product Overview : | Recombinant Human BMP2 protein(Gln283~Arg396), fused with N-terminal His tag, was expressed in E. coli. |
Availability | October 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Gln283~Arg396 |
Tag : | N-His |
Form : | Lyophilized from sterile PBS, pH7.4. |
Bio-activity : | Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. |
Molecular Mass : | The protein has a calculated MW of 14.2 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute in 10mM PBS (pH7.4) to a concentration of 1.0 mg/mL. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MGHHHHHHSGSEFQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR |
Gene Name | BMP2 bone morphogenetic protein 2 [ Homo sapiens ] |
Official Symbol | BMP2 |
Synonyms | BMP2; bone morphogenetic protein 2; BMP2A; BMP-2A; bone morphogenetic protein 2A; BDA2; |
Gene ID | 650 |
mRNA Refseq | NM_001200 |
Protein Refseq | NP_001191 |
MIM | 112261 |
UniProt ID | P12643 |
◆ Recombinant Proteins | ||
BMP2-16H | Active Recombinant Human/Mouse/Rat/Rhesus/Canine BMP2 protein(Gln283-Arg396), hFc-tagged | +Inquiry |
BMP2-124H | Active Recombinant Human BMP2, Fc-tagged | +Inquiry |
BMP2-123H | Active GMP Recombinant Human BMP2 | +Inquiry |
BMP2-210H | Recombinant Human BMP2 protein, His/S-tagged | +Inquiry |
BMP2-35H | Recombinant Human Bone Morphogenetic Protein 2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP2-3075HCL | Recombinant Human BMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP2 Products
Required fields are marked with *
My Review for All BMP2 Products
Required fields are marked with *