Active Recombinant Human BMP2 protein
| Cat.No. : | BMP2-011H |
| Product Overview : | Recombinant Human BMP2 protein(Gln283~Arg396), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | January 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Gln283~Arg396 |
| Tag : | N-His |
| Form : | Lyophilized from sterile PBS, pH7.4. |
| Bio-activity : | Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. |
| Molecular Mass : | The protein has a calculated MW of 14.2 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute in 10mM PBS (pH7.4) to a concentration of 1.0 mg/mL. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MGHHHHHHSGSEFQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR |
| Gene Name | BMP2 bone morphogenetic protein 2 [ Homo sapiens ] |
| Official Symbol | BMP2 |
| Synonyms | BMP2; bone morphogenetic protein 2; BMP2A; BMP-2A; bone morphogenetic protein 2A; BDA2; |
| Gene ID | 650 |
| mRNA Refseq | NM_001200 |
| Protein Refseq | NP_001191 |
| MIM | 112261 |
| UniProt ID | P12643 |
| ◆ Recombinant Proteins | ||
| BMP2-1597H | Recombinant Human BMP2 Protein (Gln283-Arg396) | +Inquiry |
| BMP2-2430M | Recombinant Mouse BMP2 Protein | +Inquiry |
| BMP2-566R | Recombinant Rabbit BMP2 protein, His-tagged | +Inquiry |
| BMP2-10249H | Recombinant Human BMP2, GST-tagged | +Inquiry |
| BMP2-560H | Active Recombinant Human BMP2 protein, His-GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMP2-3075HCL | Recombinant Human BMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP2 Products
Required fields are marked with *
My Review for All BMP2 Products
Required fields are marked with *
