Active Recombinant Human BMP2 protein

• Cat.No.: BMP2-011H
• Product Overview: Recombinant Human BMP2 protein(Gln283~Arg396), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Gln283~Arg396
• Tag: N-His
• Form: Lyophilized from sterile PBS, pH7.4.
• Bio-activity: Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells.
• Molecular Mass: The protein has a calculated MW of 14.2 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute in 10mM PBS (pH7.4) to a concentration of 1.0 mg/mL. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MGHHHHHHSGSEFQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR

Gene Information

• Gene Name: BMP2 bone morphogenetic protein 2 [ Homo sapiens ]
• Official Symbol: BMP2
• Synonyms: BMP2; bone morphogenetic protein 2; BMP2A; BMP-2A; bone morphogenetic protein 2A; BDA2
• Gene ID: 650
• mRNA Refseq: NM_001200
• Protein Refseq: NP_001191
• MIM: 112261
• UniProt ID: P12643