Active Recombinant Human BMP2 protein

Cat.No. : BMP2-011H
Product Overview : Recombinant Human BMP2 protein(Gln283~Arg396), fused with N-terminal His tag, was expressed in E. coli.
Availability May 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Gln283~Arg396
Tag : N-His
Form : Lyophilized from sterile PBS, pH7.4.
Bio-activity : Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells.
Molecular Mass : The protein has a calculated MW of 14.2 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute in 10mM PBS (pH7.4) to a concentration of 1.0 mg/mL. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MGHHHHHHSGSEFQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
Gene Name BMP2 bone morphogenetic protein 2 [ Homo sapiens ]
Official Symbol BMP2
Synonyms BMP2; bone morphogenetic protein 2; BMP2A; BMP-2A; bone morphogenetic protein 2A; BDA2;
Gene ID 650
mRNA Refseq NM_001200
Protein Refseq NP_001191
MIM 112261
UniProt ID P12643

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BMP2 Products

Required fields are marked with *

My Review for All BMP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon