Active Recombinant Human BRAF Protein, GST-tagged

Cat.No. : BRAF-321H
Product Overview : Human BRAF partial ORF ( NP_004324, 346 a.a. - 445 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein belonging to the raf/mil family of serine/threonine protein kinases. This protein plays a role in regulating the MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. Mutations in this gene are associated with cardiofaciocutaneous syndrome, a disease characterized by heart defects, mental retardation and a distinctive facial appearance. Mutations in this gene have also been associated with various cancers, including non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, non-small cell lung carcinoma, and adenocarcinoma of lung. A pseudogene, which is located on chromosome X, has been identified for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Bio-activity : The activity was determined by ELISA. The enzyme was incubated with GST-fused substrate protein, and after stopping kinase reaction by EDTA, the reaction solution was transferred into glutathione-coated plate. Phosphorylation was detected by anti-phospho antibody and HRP-labeled anti-rabbit IgG (or HRP-labeled anti-mouse IgG).Substrate : MAP2K1 [inactive mutant]. ATP: 100 µM.
Molecular Mass : 36.74 kDa
AA Sequence : FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRD
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BRAF v-raf murine sarcoma viral oncogene homolog B1 [ Homo sapiens ]
Official Symbol BRAF
Synonyms BRAF; v-raf murine sarcoma viral oncogene homolog B1; serine/threonine-protein kinase B-raf; BRAF1; p94; 94 kDa B-raf protein; proto-oncogene B-Raf; murine sarcoma viral (v-raf) oncogene homolog B1; B-Raf proto-oncogene serine/threonine-protein kinase (p94); NS7; RAFB1; B-RAF1; FLJ95109; MGC126806; MGC138284;
Gene ID 673
mRNA Refseq NM_004333
Protein Refseq NP_004324
MIM 164757
UniProt ID P15056

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BRAF Products

Required fields are marked with *

My Review for All BRAF Products

Required fields are marked with *

0
cart-icon
0
compare icon