Active Recombinant Human CA10 Protein (22-328aa), C-His-tagged

Cat.No. : CA10-16H
Product Overview : Recombinant human Carbonic Anhydrase X/CA10 (22-328aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 22-328 aa
Description : Carbonic anhydrase X, also known as CA10, belongs to the CA family of zinc metalloenzymes. It is catalyze the reversible hydration of carbon dioxide in various biological processes such as respiration, renal tubular acidification and bone resorption. Also an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development.
Form : Liquid
Bio-activity : Specific activity is > 150 pmol/min/μg, and is defined as the amount of enzyme that hydrolyze 1pmole of p-nitrophenyl acetate to p-nitrophenol per minute at pH 8.0 at 37 centigrade.
Molecular Mass : 36.3 kDa (317 aa)
AA Sequence : QQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Enzyme Activity
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Absorbance at 280 nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name CA10 carbonic anhydrase X [ Homo sapiens (human) ]
Official Symbol CA10
Synonyms CA10; carbonic anhydrase X; carbonic anhydrase-related protein 10; CA RPX; CARPX; HUCEP 15; CARP X; CA-RP X; cerebral protein 15; cerebral protein-15; carbonic anhydrase-related protein X; CA-RPX; HUCEP-15
Gene ID 56934
mRNA Refseq NM_020178
Protein Refseq NP_064563
MIM 604642
UniProt ID Q9NS85

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CA10 Products

Required fields are marked with *

My Review for All CA10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon