| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
His |
| Protein Length : |
22-328 aa |
| Description : |
Carbonic anhydrase X, also known as CA10, belongs to the CA family of zinc metalloenzymes. It is catalyze the reversible hydration of carbon dioxide in various biological processes such as respiration, renal tubular acidification and bone resorption. Also an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development. |
| Form : |
Liquid |
| Bio-activity : |
Specific activity is > 150 pmol/min/μg, and is defined as the amount of enzyme that hydrolyze 1pmole of p-nitrophenyl acetate to p-nitrophenol per minute at pH 8.0 at 37 centigrade. |
| Molecular Mass : |
36.3 kDa (317 aa) |
| AA Sequence : |
QQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK |
| Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
| Purity : |
> 95% by SDS-PAGE |
| Applications : |
SDS-PAGE, Enzyme Activity |
| Notes : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
0.5 mg/mL (determined by Absorbance at 280 nm) |
| Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
